Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55171.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:71 amino acids
:HMM:PFM   30->51 PF02330 * MAM33 0.00032 40.9 22/204  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55171.1 GT:GENE BAD55171.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(343193..343408) GB:FROM 343193 GB:TO 343408 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55171.1 LENGTH 71 SQ:AASEQ MSSDESTASRTGRGSRPRLFVRDDAESGTVVPSIDEQLYDTLARYLIARDIQGFGGGRVMLYRDGTTGERP GT:EXON 1|1-71:0| HM:PFM:NREP 1 HM:PFM:REP 30->51|PF02330|0.00032|40.9|22/204|MAM33| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-17, 67-71| PSIPRED cccccccHHccccccccEEEEEcccccccccccHHHHHHHHHHHHHHHHHcccccccEEEEEEcccccccc //