[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55172.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:74 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   17->52 PF10756 * DUF2581 0.00058 30.6 36/73  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55172.1 GT:GENE BAD55172.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(343421..343645) GB:FROM 343421 GB:TO 343645 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55172.1 LENGTH 74 SQ:AASEQ MFGVLCRLAGVNGLVALRYPAGARLLRARCDRLHPVSRVTAGQASDVVRSATSHPAVTISLIHAEPTLLIKIAS GT:EXON 1|1-74:0| HM:PFM:NREP 1 HM:PFM:REP 17->52|PF10756|0.00058|30.6|36/73|DUF2581| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 48-48,53-54,59-60,62-62,66-67,73-75| PSIPRED ccEEEEEEcccccEEEEEEcccHHHHHHHHcccccHHHcccccHHHHHHHcccccEEEEEEEEcccEEEEEEcc //