[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55175.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:115 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   4->33 PF04149 * DUF397 3e-04 56.7 %
:HMM:PFM   3->53 PF04149 * DUF397 1.8e-13 40.4 47/56  
:HMM:PFM   60->108 PF04149 * DUF397 5.8e-05 28.6 49/56  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55175.1 GT:GENE BAD55175.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 345177..345524 GB:FROM 345177 GB:TO 345524 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55175.1 LENGTH 115 SQ:AASEQ MSTRFYKSSYSGANNSCVEVAHRSDGVLIQDSKYTGNRSSQPRIRVARSEWPSVLDLAVSRRSGRVGDLTVDVASDGSSILTGPSEAGDKVTLHYTPTEWDAFAKGVVDGEFDLR GT:EXON 1|1-115:0| RP:PFM:NREP 1 RP:PFM:REP 4->33|PF04149|3e-04|56.7|30/55|DUF397| HM:PFM:NREP 2 HM:PFM:REP 3->53|PF04149|1.8e-13|40.4|47/56|DUF397| HM:PFM:REP 60->108|PF04149|5.8e-05|28.6|49/56|DUF397| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED ccccEEEEEEEcccccEEEEEEcccEEEEEEcccccccccccEEEEEccccHHHHHHHHHHccccccccccEEEccccEEEEccccccccEEEEEEHHHHHHHHHHccccccccc //