Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55177.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:50 amino acids
:HMM:PFM   3->33 PF00589 * Phage_integrase 0.00057 22.6 31/173  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55177.1 GT:GENE BAD55177.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 346649..346801 GB:FROM 346649 GB:TO 346801 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55177.1 LENGTH 50 SQ:AASEQ MPVSRLADNGVPPHMIAVVIRHGNVARTYRHKTRKTGGRHAVGRSMRDNE GT:EXON 1|1-50:0| HM:PFM:NREP 1 HM:PFM:REP 3->33|PF00589|0.00057|22.6|31/173|Phage_integrase| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 6-7, 39-50| PSIPRED ccccccccccccHHHHHHHHccccHHHHHHHHHHcccccccccccccccc //