[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55178.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:297 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   228->251 2ux8G PDBj 8e-04 54.2 %
:HMM:PFM   56->87 PF12555 * TPPK_C 0.00045 44.8 29/53  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55178.1 GT:GENE BAD55178.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(347046..347939) GB:FROM 347046 GB:TO 347939 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55178.1 LENGTH 297 SQ:AASEQ MGRVACRERTSVEEGTTVHGGFDRDMGDTATRTTPIPPQGLSAPPGHHDDMAVARELYRPSSGGHRWIGLGMAVLAVLGGTAVAVLADGSDAAEADDATGMVSALTPSTRTRTTEQPVISAPAVVPGYRAVVAPDSDAAYDVPADWTIAPPDRSGGFGKPPNTIGGKGYASEGKDYCPGSTRTVAFLTGSPTTDTTAAALEVGARAARIAYLADPTPTAPEPLHSLDGTQHGTFAETRGLIRDPAPGCAPTFSIYTFATPADTGSLVMVIAADTGVPKAVDPDTAKRIFTSIRPYKP GT:EXON 1|1-297:0| SEG 69->98|glgmavlavlggtavavladgsdaaeadda| SEG 197->210|aaalevgaraaria| BL:PDB:NREP 1 BL:PDB:REP 228->251|2ux8G|8e-04|54.2|24/288| HM:PFM:NREP 1 HM:PFM:REP 56->87|PF12555|0.00045|44.8|29/53|TPPK_C| OP:NHOMO 3 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------2-----------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 92-113, 296-297| PSIPRED ccccccccccccccccEEEcccccccccccccccccccccccccccccHHHHHHHHHHcccccccEEEHHHHHHHHHHcccEEEEEEccccccccccccccccccccccccccccccEEcccccccccEEEEEcccccEEEcccccEEcccccEEEccccccEEEEEEEccccccccccccEEEEEEEcccccccccHHHHHHHccEEEEEEccccccccccccHHccccccEEEEEEccccccccccccccEEEEEEEccccccEEEEEEccccccccccHHHHHHHHHHHccccc //