[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55180.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  425/915 : Eukaryota  8/199 : Viruses  0/175   --->[See Alignment]
a.182.1
:180 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   30->180 1ng6A PDBj 5e-15 33.1 %
:RPS:PDB   21->139 3bmaE PDBj 1e-11 9.6 %
:RPS:SCOP  30->180 1ng6A  a.182.1.1 * 7e-33 32.4 %
:HMM:SCOP  28->181 1ng6A_ a.182.1.1 * 8.6e-37 42.6 %
:RPS:PFM   31->180 PF09424 * YqeY 9e-19 45.5 %
:HMM:PFM   31->180 PF09424 * YqeY 1.8e-51 51.7 143/143  
:BLT:SWISS 30->180 YQEY_BACSU 1e-14 33.1 %
:PROS 164->172|PS00697|DNA_LIGASE_A1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55180.1 GT:GENE BAD55180.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 349088..349630 GB:FROM 349088 GB:TO 349630 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55180.1 LENGTH 180 SQ:AASEQ MPGRDGPGGTAEMWWGGTGGPTTVRPMSELKERLRADMTAAMKAKDTLRLATLRMLLAAIQNAEVAGAQARELSDAEVIAVLQKEAKKRNESAEVYTQAGRGELAANEHAEARIIDEYLPTQLSEAEVADLADTAIAQVAEQLGERPGMRQMGQVMKIATQLAQGKADGSRISAAVKARL GT:EXON 1|1-180:0| BL:SWS:NREP 1 BL:SWS:REP 30->180|YQEY_BACSU|1e-14|33.1|145/148| PROS 164->172|PS00697|DNA_LIGASE_A1|PDOC00295| SEG 47->59|tlrlatlrmllaa| BL:PDB:NREP 1 BL:PDB:REP 30->180|1ng6A|5e-15|33.1|145/148| RP:PDB:NREP 1 RP:PDB:REP 21->139|3bmaE|1e-11|9.6|114/390| RP:PFM:NREP 1 RP:PFM:REP 31->180|PF09424|9e-19|45.5|143/143|YqeY| HM:PFM:NREP 1 HM:PFM:REP 31->180|PF09424|1.8e-51|51.7|143/143|YqeY| RP:SCP:NREP 1 RP:SCP:REP 30->180|1ng6A|7e-33|32.4|145/148|a.182.1.1| HM:SCP:REP 28->181|1ng6A_|8.6e-37|42.6|148/148|a.182.1.1|1/1|GatB/YqeY motif| OP:NHOMO 433 OP:NHOMOORG 433 OP:PATTERN -------------------------------------------------------------------- 11--1111111-1--1111-1---11111111-111111111111--1-----11-------1-1-111111-------------111111--111---11-1111111----------------11-111111-1-111111111-11---------------------1--------------------111-----1--1---1--111111---111111111111111--------------------111-11-1111111111111111-----------------------------------------------1-111-------1-11---1111-11--1--1-11-1--1111--111--------------111111111111111111111-11-11-11-11111-1111111111111---1-111-111-111111111------1-------------------------------111-1111111-11111111111111111-11111111111111111111111111111111111111111111-11-----11-111111111-11-1-11111-11111111111-----------11-111111---11-111-1111111----1-11-11---11-1--------------------------------------------------------------------------------------------1111-11111111-1---------------1111111111-11111-------------111111111111111111111111-------1111111--1-111111------------------------------------1111--1---111 --------------1--------------------------------------------111---------------------------1---1----------------------------------------------------------------------------------11--------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 155 STR:RPRED 86.1 SQ:SECSTR ####################HHHccHHHHHHHHHHccccHHHHHHHHHHHHHcTTcTTHHHHHHHHTTcccccHHHHHHHHHHHHHHHHHHHHHTTcccHHHHHHHHTHHHHHHHGTTccccccHHHHHHHHHHHHHHHTcc#####cGGGHHHHHHHHHHHHTTTccHHHHHHHHHHHc DISOP:02AL 1-8, 16-26, 66-70| PSIPRED cccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHc //