[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55185.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  55/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:51 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   16->29 PF08310 * LGFP 0.00029 64.3 14/54  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55185.1 GT:GENE BAD55185.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 355070..355225 GB:FROM 355070 GB:TO 355225 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55185.1 LENGTH 51 SQ:AASEQ MTTWEYATVPLLTHATKQILDQWGADGWELVTVLPGPTGEQHVAYLKRPKQ GT:EXON 1|1-51:0| HM:PFM:NREP 1 HM:PFM:REP 16->29|PF08310|0.00029|64.3|14/54|LGFP| OP:NHOMO 55 OP:NHOMOORG 55 OP:PATTERN -------------------------------------------------------------------- ----1-1111111111-11-1---1111--11111111-1111111111111111111-11-1-1111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 50-51| PSIPRED ccccccccccHHHHHHHHHHHHcccccEEEEEEEEccccccEEEEEEcccc //