[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55186.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  270/915 : Eukaryota  10/199 : Viruses  0/175   --->[See Alignment]
d.79.1
:156 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   34->154 3d01L PDBj 1e-21 42.9 %
:RPS:PDB   33->154 3d01C PDBj 5e-17 38.3 %
:RPS:SCOP  9->154 2otmA1  d.79.1.1 * 2e-38 25.3 %
:HMM:SCOP  13->155 1qu9A_ d.79.1.1 * 8.4e-26 37.7 %
:RPS:PFM   33->151 PF01042 * Ribonuc_L-PSP 6e-04 43.1 %
:HMM:PFM   23->154 PF01042 * Ribonuc_L-PSP 4.5e-25 39.7 116/121  
:BLT:SWISS 37->155 ALDR_LACLA 1e-05 36.4 %
:PROS 128->135|PS00369|PTS_HPR_HIS
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55186.1 GT:GENE BAD55186.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 355235..355705 GB:FROM 355235 GB:TO 355705 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55186.1 LENGTH 156 SQ:AASEQ MESATRWRENLDRLGVTLPAVAAPVAAYIPAIRTGSLVYTSGQLPFVDGELSAVGKVGAEVSLETAKEAARLCALNALAAVHDLISLDEVTRIVKVVGFVASAPGFTDQPIVVNGASELLGEVFGEAGVHARSAVGVAELPKNAPVEVELVVEVRG GT:EXON 1|1-156:0| BL:SWS:NREP 1 BL:SWS:REP 37->155|ALDR_LACLA|1e-05|36.4|99/126| PROS 128->135|PS00369|PTS_HPR_HIS|PDOC00318| SEG 19->32|pavaapvaayipai| SEG 69->80|aarlcalnalaa| BL:PDB:NREP 1 BL:PDB:REP 34->154|3d01L|1e-21|42.9|119/157| RP:PDB:NREP 1 RP:PDB:REP 33->154|3d01C|5e-17|38.3|120/154| RP:PFM:NREP 1 RP:PFM:REP 33->151|PF01042|6e-04|43.1|102/119|Ribonuc_L-PSP| HM:PFM:NREP 1 HM:PFM:REP 23->154|PF01042|4.5e-25|39.7|116/121|Ribonuc_L-PSP| RP:SCP:NREP 1 RP:SCP:REP 9->154|2otmA1|2e-38|25.3|146/152|d.79.1.1| HM:SCP:REP 13->155|1qu9A_|8.4e-26|37.7|122/0|d.79.1.1|1/1|YjgF-like| OP:NHOMO 379 OP:NHOMOORG 282 OP:PATTERN ------------------------------------------------------------------11 -111111122211111111-111114111111111112421111111111112121111111112121111-----------1----------1-------2--21-2-----------------11111111111---------1------------------------------------------------------1--1------------1---1----------1-------------------------------------------------------------------------------------------------1--1-1----------------1--21111----11------1--11111211111111111121111111111111112-11211111121-2222552754211221112211111111111111111111111-----------------------------111111-11113222241111111411111113133352111112211121214112---------------------------------------------------------------------------------------1-----------------1---------------------1----------------------------------------------------------------------------------------------------------------1--11------111-122-----------------------------------1---------------111111-----------------------------------------------11 --------21------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------2222221 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 152 STR:RPRED 97.4 SQ:SECSTR ###HHHHHTcccccHHHHHHHGGGccccccccEETTEEEEEEEccETTTEEccccccTTTccHHHHHHHHHHHHHHHHHHHHHHTcGGGEEEEEEEEEEEEccTTcccHHHHHHHHHHHHHHHHcGGGcccEEEEEEEccGGGccEEEEEEEEEc# DISOP:02AL 1-4| PSIPRED cccHHHHHHHHHHHccccccccccccccccEEEEccEEEEEEEEEEEcccEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEcccccccccEEEEEEEEEcc //