[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55188.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  461/915 : Eukaryota  14/199 : Viruses  0/175   --->[See Alignment]
a.4.5b.82.3
:224 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->224 3d0sA PDBj 4e-97 86.2 %
:RPS:PDB   1->224 3d0sA PDBj 8e-27 79.0 %
:RPS:SCOP  5->122 2h6bA2  b.82.3.2 * 1e-17 14.8 %
:RPS:SCOP  146->224 2gauA1  a.4.5.4 * 9e-08 35.9 %
:HMM:SCOP  2->132 1ne6A2 b.82.3.2 * 4.1e-37 45.0 %
:HMM:SCOP  145->226 2gauA1 a.4.5.4 * 4.6e-19 37.0 %
:RPS:PFM   31->88 PF00027 * cNMP_binding 2e-15 51.7 %
:RPS:PFM   141->211 PF04492 * Phage_rep_O 1e-04 29.9 %
:HMM:PFM   29->118 PF00027 * cNMP_binding 5.2e-29 41.1 90/91  
:HMM:PFM   174->202 PF00325 * Crp 8.6e-08 34.5 29/32  
:BLT:SWISS 31->213 CRP_HAEIN 8e-15 27.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55188.1 GT:GENE BAD55188.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(356617..357291) GB:FROM 356617 GB:TO 357291 GB:DIRECTION - GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD55188.1 LENGTH 224 SQ:AASEQ MDEALARAGIFQGVEPTAVAALAKQLQPVDFPRGHVIFNEGEPGDRLYIITSGKVKIGRRSPDGRENLLTIMGPSDMFGELSIFDPGPRTSTATTVTEVRAVTMDRDALKSWIDQRPEIAEQLLRVLARRLRRTNNNLADLIFTDVPGRVAKALLQLAQRFGTQEAGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWLRLEGKSVLISDSERLARRAR GT:EXON 1|1-224:0| BL:SWS:NREP 1 BL:SWS:REP 31->213|CRP_HAEIN|8e-15|27.8|176/224| SEG 89->103|rtstattvtevravt| SEG 123->138|llrvlarrlrrtnnnl| BL:PDB:NREP 1 BL:PDB:REP 1->224|3d0sA|4e-97|86.2|224/224| RP:PDB:NREP 1 RP:PDB:REP 1->224|3d0sA|8e-27|79.0|224/224| RP:PFM:NREP 2 RP:PFM:REP 31->88|PF00027|2e-15|51.7|58/90|cNMP_binding| RP:PFM:REP 141->211|PF04492|1e-04|29.9|67/97|Phage_rep_O| HM:PFM:NREP 2 HM:PFM:REP 29->118|PF00027|5.2e-29|41.1|90/91|cNMP_binding| HM:PFM:REP 174->202|PF00325|8.6e-08|34.5|29/32|Crp| GO:PFM:NREP 1 GO:PFM GO:0006260|"GO:DNA replication"|PF04492|IPR006497| RP:SCP:NREP 2 RP:SCP:REP 5->122|2h6bA2|1e-17|14.8|115/145|b.82.3.2| RP:SCP:REP 146->224|2gauA1|9e-08|35.9|78/81|a.4.5.4| HM:SCP:REP 2->132|1ne6A2|4.1e-37|45.0|131/0|b.82.3.2|1/1|cAMP-binding domain-like| HM:SCP:REP 145->226|2gauA1|4.6e-19|37.0|81/0|a.4.5.4|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 674 OP:NHOMOORG 475 OP:PATTERN -------------------------------------------------------------------- 135-211222211123222-22111222222111111111132411223---111111--533121121111111111----4--11-------11--------1111-1----------------1-------1-533231-11-2--1----111------11--211-------------1311111--11111111-11111111--22-1111-231-12------11----------------------1---------------1-1------------------------------------------------1-23-233333332311----222-11-11--135533--3111111----12----2------132412-2-22222212222222-23111312--1--11-1-2---22111----1----111--------1----31--------------------------------121-1----11111112121112-222222111--2---22112---112-11--2--11------------11114311111-23111-21232221211-14523-------------------------111111----1-11111111111111111111---1---------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111---1-----------2--111-1-11111111111111-1---11----11-2-1111--11----------11111111111111------------------111111--------111-------------------------------------- ----11---------------------------------1----------------------------------------------------------------------------------1-31--1481-----1--1----------------------1----------------------------------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 224 STR:RPRED 100.0 SQ:SECSTR cHccccccccccccccGGGGGGGGGcEEEEEcTTcEEEcTTcccccEEEEEEccEEEEEEcTTccEEEEEEEcTTcEEcccccccccccEEEEEEcccEEEEEEcHHHHHHHHHHcTHHHHHHHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHHcEEETTEEEEcccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEccccEEEccHHHHHHHHH PSIPRED cHHHHHHcHHHccccHHHHHHHHHHcEEEEEccccEEEcccccccEEEEEEEEEEEEEEEcccccEEEEEEEccccEEEEHHHHcccccEEEEEEEccEEEEEEEHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccccEEEEEEccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEccEEEEEcHHHHHHHcc //