[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55191.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  30/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:209 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   101->136 1rqmA PDBj 1e-05 50.0 %
:RPS:PDB   101->205 3c73A PDBj 4e-08 21.4 %
:RPS:SCOP  101->188 1z5yE1  c.47.1.10 * 2e-07 21.2 %
:HMM:SCOP  80->206 1q98A_ c.47.1.10 * 4.4e-23 32.3 %
:RPS:PFM   101->146 PF08534 * Redoxin 6e-04 40.0 %
:HMM:PFM   75->197 PF08534 * Redoxin 2e-15 23.5 119/146  
:HMM:PFM   2->31 PF12555 * TPPK_C 0.00089 48.3 29/53  
:BLT:SWISS 101->188 RESA_BACCZ 1e-05 25.3 %
:PROS 97->115|PS00194|THIOREDOXIN_1
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55191.1 GT:GENE BAD55191.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 358634..359263 GB:FROM 358634 GB:TO 359263 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55191.1 LENGTH 209 SQ:AASEQ MSRVPVWVRLALAGLITVVALAVALWPRDAGEPATGSGAPTGGAVSAQLRADAALAPCPGPAPGAVGAGPLAGLTPTCLADGAPVDLAAALAGKPALLNLWAYWCGPCAEELPHLREYVSRVGDRVTVLTVHSDPEEAKALSRLTGLDVHLPGVLDPDARVRAAVGAPAVLPISVLVRPDGSVAEVVVRTFTGVDDIAATVQRALGVPM GT:EXON 1|1-209:0| BL:SWS:NREP 1 BL:SWS:REP 101->188|RESA_BACCZ|1e-05|25.3|87/173| PROS 97->115|PS00194|THIOREDOXIN_1|PDOC00172| TM:NTM 2 TM:REGION 7->29| TM:REGION 56->78| SEG 30->47|agepatgsgaptggavsa| SEG 51->74|adaalapcpgpapgavgagplagl| SEG 87->100|laaalagkpallnl| SEG 156->169|dpdarvraavgapa| BL:PDB:NREP 1 BL:PDB:REP 101->136|1rqmA|1e-05|50.0|36/105| RP:PDB:NREP 1 RP:PDB:REP 101->205|3c73A|4e-08|21.4|103/136| RP:PFM:NREP 1 RP:PFM:REP 101->146|PF08534|6e-04|40.0|45/132|Redoxin| HM:PFM:NREP 2 HM:PFM:REP 75->197|PF08534|2e-15|23.5|119/146|Redoxin| HM:PFM:REP 2->31|PF12555|0.00089|48.3|29/53|TPPK_C| GO:PFM:NREP 1 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF08534|IPR013740| RP:SCP:NREP 1 RP:SCP:REP 101->188|1z5yE1|2e-07|21.2|85/136|c.47.1.10| HM:SCP:REP 80->206|1q98A_|4.4e-23|32.3|124/0|c.47.1.10|1/1|Thioredoxin-like| OP:NHOMO 31 OP:NHOMOORG 30 OP:PATTERN -------------------------------------------------------------------- -------1111---11111-11111111111111111211------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 129 STR:RPRED 61.7 SQ:SECSTR ################################################################################EEEEETHHHHTTTcEEEEEEEcTTcHHHHHHHHHHHHHHHHHGGGEEEEEEEccccHHHHHHHHHHTTccccHEEEcTTcHHHHHTTcccccEEEEEcTTccEEEEEcccccHHHHHHHHHHHHcTTTc DISOP:02AL 1-4, 34-41| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEHHHHHcccEEEEEEEccccHHHHHHHHHHHHHHHHHcccEEEEEEEccccHHHHHHHHHHcccccEEEEcccHHHHHHccccccccEEEEEccccEEEEEEEcccccHHHHHHHHHHHHcccc //