[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55195.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  35/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:168 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   35->148 PF07332 * DUF1469 5e-08 30.4 %
:HMM:PFM   35->149 PF07332 * DUF1469 3.5e-34 37.4 115/121  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55195.1 GT:GENE BAD55195.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(362300..362806) GB:FROM 362300 GB:TO 362806 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55195.1 LENGTH 168 SQ:AASEQ MSFTQGGNGNDARSGSTVSSIPLTDANPPGSASFGALVRDAAEQMSTLVRAEVELAKAEVTGEIKKGLQGSVFFILALTVLLFSTFFFFFFLGELLDVWLARWAAFLIVFLLMIAATAVLGFLGYRRVKKLRAPEKTIDSLKQARTVLPSGFGQAAHEDHLVLEKRTN GT:EXON 1|1-168:0| TM:NTM 2 TM:REGION 72->94| TM:REGION 104->125| SEG 76->96|laltvllfstfffffflgell| RP:PFM:NREP 1 RP:PFM:REP 35->148|PF07332|5e-08|30.4|112/119|DUF1469| HM:PFM:NREP 1 HM:PFM:REP 35->149|PF07332|3.5e-34|37.4|115/121|DUF1469| OP:NHOMO 35 OP:NHOMOORG 35 OP:PATTERN -------------------------------------------------------------------- -----111111-1111111-1111111-111111111111------------------------111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-9, 130-140, 166-168| PSIPRED ccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccccccHHHHHHHHHHcccc //