[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55206.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:120 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   25->101 PF03799 * FtsQ 0.001 21.3 75/117  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55206.1 GT:GENE BAD55206.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 375786..376148 GB:FROM 375786 GB:TO 376148 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55206.1 LENGTH 120 SQ:AASEQ MSGRGGEEGGATVFACVALVGLIAVTLLIAQVGTVVVARHRVQAAADLGALAGAGALQAGADEACAAAEAVVRRMGALVSECEVMRWDVTVSVERIVRMGAVGARTVRASARAGPAEQED GT:EXON 1|1-120:0| TM:NTM 1 TM:REGION 10->32| SEG 35->70|vvvarhrvqaaadlgalagagalqagadeacaaaea| HM:PFM:NREP 1 HM:PFM:REP 25->101|PF03799|0.001|21.3|75/117|FtsQ| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-9, 110-120| PSIPRED ccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHccccccccc //