[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55208.1
DDBJ      :             putative cold shock protein
Swiss-Prot:             

Homologs  Archaea  10/68 : Bacteria  694/915 : Eukaryota  77/199 : Viruses  1/175   --->[See Alignment]
b.40.4
:68 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   4->67 1mjcA PDBj 1e-20 60.9 %
:RPS:PDB   1->67 1c9oA PDBj 8e-21 63.6 %
:RPS:SCOP  1->67 1c9oA  b.40.4.5 * 3e-21 63.6 %
:HMM:SCOP  1->68 1h95A_ b.40.4.5 * 4.3e-27 61.8 %
:RPS:PFM   2->64 PF00313 * CSD 1e-19 71.4 %
:HMM:PFM   1->66 PF00313 * CSD 4.3e-36 63.6 66/67  
:BLT:SWISS 1->67 CSPA_MYCTU 3e-32 88.1 %
:PROS 15->34|PS00352|COLD_SHOCK

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55208.1 GT:GENE BAD55208.1 GT:PRODUCT putative cold shock protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 379275..379481 GB:FROM 379275 GB:TO 379481 GB:DIRECTION + GB:PRODUCT putative cold shock protein GB:PROTEIN_ID BAD55208.1 LENGTH 68 SQ:AASEQ MAQGTVKWFNAEKGFGFIAPEDGSADVFVHYSEIQGSGFRTLEENQKVEFEVGQGTKGPQATGVRALS GT:EXON 1|1-68:0| BL:SWS:NREP 1 BL:SWS:REP 1->67|CSPA_MYCTU|3e-32|88.1|67/67| PROS 15->34|PS00352|COLD_SHOCK|PDOC00304| BL:PDB:NREP 1 BL:PDB:REP 4->67|1mjcA|1e-20|60.9|64/69| RP:PDB:NREP 1 RP:PDB:REP 1->67|1c9oA|8e-21|63.6|66/66| RP:PFM:NREP 1 RP:PFM:REP 2->64|PF00313|1e-19|71.4|63/67|CSD| HM:PFM:NREP 1 HM:PFM:REP 1->66|PF00313|4.3e-36|63.6|66/67|CSD| GO:PFM:NREP 2 GO:PFM GO:0003677|"GO:DNA binding"|PF00313|IPR002059| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00313|IPR002059| RP:SCP:NREP 1 RP:SCP:REP 1->67|1c9oA|3e-21|63.6|66/66|b.40.4.5| HM:SCP:REP 1->68|1h95A_|4.3e-27|61.8|68/0|b.40.4.5|1/1|Nucleic acid-binding proteins| OP:NHOMO 2551 OP:NHOMOORG 782 OP:PATTERN ------------------------31152223----------------------------------11 553-711322211123311-14223311111233336585233442221223465312--443-54688621-112221-21411122-----------1-1-31--534---------------11112122311-----------1-----------------------------------32122--2123666666666666676213333667211436233333365-33333333333332222235-213311-1-4322334212212561111111--------------1111111111111-11222111312222222322311-1445211-5-1-2-11--11241-242111112112--33341111153C55C445555633233333233-66386555494-6554655997974422232565454333333333323333334------------11--111111111----22242155555666566533324467444434557586512444211--------3212323231111111224233-4526-----1----666334653555561551-------------------1---1114433564349B433333332332333333411-121311122245445737557755-66-56855557755775576564544455655554454445555557554555531A858987687991122-----6665245452221222111111123422423334445555666656666555522222222224448444444444433333333332222115-----------------11111----1--------1-------2311122212--- --11----------1-------1---------------------------1-------------------------------------------------1--11---5--3224121-11131781615J3-519-1-25--321212-4-14-3211--12721-111-2121--11A211123144-4433----1 ---------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------- STR:NPRED 67 STR:RPRED 98.5 SQ:SECSTR cEEEEEEEEETTTTEEEEEETTEEcEEEEEGGGccccccccccTTcEEEEEEEEETTEEEEEEEEEc# PSIPRED ccccEEEEEEccccEEEEEEcccccEEEEEEEEEccccccccccccEEEEEEEEcccccEEEEEEEcc //