[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55211.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  120/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
c.71.1
:183 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->177 2gd9A PDBj 4e-22 37.7 %
:RPS:PDB   1->180 2blcA PDBj 1e-23 12.5 %
:RPS:SCOP  1->180 1j3iA  c.71.1.1 * 2e-24 10.8 %
:HMM:SCOP  2->182 1d1gA_ c.71.1.1 * 1.6e-29 35.2 %
:RPS:PFM   108->172 PF01872 * RibD_C 4e-09 46.2 %
:HMM:PFM   3->177 PF01872 * RibD_C 1.2e-25 25.1 167/200  
:BLT:SWISS 2->177 YYAP_BACSU 1e-25 36.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55211.1 GT:GENE BAD55211.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(384454..385005) GB:FROM 384454 GB:TO 385005 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55211.1 LENGTH 183 SQ:AASEQ MRKLVYGFSVSLDGYINDRAGAIDWTEPDDELHQFHNDRFREIEISLHGRRLYELMAEYWPHVPADAPPIEREFGRLWTEKPKVVFSRTVPEVHWNSTLISTNAAEEVGRLKAAGDGVIEVGGATLAASLIPHGLVDEYQMFVSPVVLGGGTPYFPVLDTRLRLRLAETRHFKTAVLLRYVTE GT:EXON 1|1-183:0| BL:SWS:NREP 1 BL:SWS:REP 2->177|YYAP_BACSU|1e-25|36.0|172/188| BL:PDB:NREP 1 BL:PDB:REP 2->177|2gd9A|4e-22|37.7|159/173| RP:PDB:NREP 1 RP:PDB:REP 1->180|2blcA|1e-23|12.5|176/215| RP:PFM:NREP 1 RP:PFM:REP 108->172|PF01872|4e-09|46.2|65/198|RibD_C| HM:PFM:NREP 1 HM:PFM:REP 3->177|PF01872|1.2e-25|25.1|167/200|RibD_C| GO:PFM:NREP 2 GO:PFM GO:0008703|"GO:5-amino-6-(5-phosphoribosylamino)uracil reductase activity"|PF01872|IPR002734| GO:PFM GO:0009231|"GO:riboflavin biosynthetic process"|PF01872|IPR002734| RP:SCP:NREP 1 RP:SCP:REP 1->180|1j3iA|2e-24|10.8|176/223|c.71.1.1| HM:SCP:REP 2->182|1d1gA_|1.6e-29|35.2|159/164|c.71.1.1|1/1|Dihydrofolate reductase-like| OP:NHOMO 233 OP:NHOMOORG 124 OP:PATTERN --------------------------------------------1-----1----------------- -11-3--2-------------2---1------12224433-3-4171--1--331--2--142-3-5322------------1----------------1-1---556-3---------------------------2211---3---------------------------------------1--------111111211-121212----12111----2-1------11-------------------2-----------11----1-----------1------------------------------------------111----------------------------11---------------1-----1--------11------------------1----11---241-1---343333-2---1---1--------------------1----------------------------------1-------------------------------------------------------------------------1-------------------2---333333--------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------11-------------1----------------------11-----------------------------33--11-----------------------------------------------2- ----------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 183 STR:RPRED 100.0 SQ:SECSTR ccTTccTTccccEEEEEEcTTcccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccEEEEEEHHGGcccTTEEEEEEcccccTTTccccEEEccHHHHHHHHHTcccccEEEccHHHHHHHHHTTcccEEEEEEEEEEEcccEEEcccccGGGGEEEEEEcccEEETTEEEEcc PSIPRED ccEEEEEEEEccccEEEccccccccccccHHHHHHHHHHHHcccEEEEccccHHHHHHHccccccccccccHHHccccccccEEEEcccccccccccEEEEccHHHHHHHHHHccccEEEEccHHHHHHHHHcccccEEEEEEEEEEEcccccccccccccccEEEEEEEEEccEEEEEEEEc //