[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55212.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.198.3
:119 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   7->115 2a1vA PDBj 2e-17 25.0 %
:RPS:SCOP  12->113 2fkiA1  d.198.3.1 * 7e-18 14.9 %
:HMM:SCOP  7->113 2a1vA1 d.198.3.1 * 1.8e-21 29.0 %
:HMM:PFM   20->109 PF04237 * DUF419 1.9e-20 34.8 89/92  
:BLT:SWISS 12->116 Y2600_MYCBO 8e-06 35.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55212.1 GT:GENE BAD55212.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(385052..385411) GB:FROM 385052 GB:TO 385411 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55212.1 LENGTH 119 SQ:AASEQ MPAGKITPMSTTGDDVRAYALSLPETTEEFAWQMPIFRVARSLFLTLPDDETSMAVRCPVIDRDELVAAEPAKFWIAPHEANNAWVRVRLAALDDHDELRAIVLDSWKLAAPKRLLDGA GT:EXON 1|1-119:0| BL:SWS:NREP 1 BL:SWS:REP 12->116|Y2600_MYCBO|8e-06|35.0|103/129| RP:PDB:NREP 1 RP:PDB:REP 7->115|2a1vA|2e-17|25.0|108/138| HM:PFM:NREP 1 HM:PFM:REP 20->109|PF04237|1.9e-20|34.8|89/92|DUF419| RP:SCP:NREP 1 RP:SCP:REP 12->113|2fkiA1|7e-18|14.9|101/118|d.198.3.1| HM:SCP:REP 7->113|2a1vA1|1.8e-21|29.0|107/0|d.198.3.1|1/1|YjbR-like| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------1----------------------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 108 STR:RPRED 90.8 SQ:SECSTR ######cccccH#HHHHHHHTTcTTEEEEccccEEEEEEEETTEEETTccccEEEEEccHHHHHHHHHHcTTTEEEcTTccTTTEEEEEccccccHHHHHHHHHHHHHHHHHHHc#### DISOP:02AL 1-4, 118-119| PSIPRED cccccEEEccccHHHHHHHHHHcccccccccccccccEEccEEEEEEEccccEEEEEcccHHHHHHHHccccEEEEccccccccEEEEEEcccccHHHHHHHHHHHHHHHccHHHHccc //