[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55214.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  98/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:130 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   17->130 2ek5C PDBj 4e-24 50.4 %
:RPS:PDB   12->130 3by6D PDBj 9e-14 24.8 %
:RPS:SCOP  16->82 1e2xA1  a.4.5.6 * 8e-13 20.9 %
:HMM:SCOP  10->108 1v4rA1 a.4.5.6 * 3.4e-12 28.3 %
:HMM:PFM   21->81 PF00392 * GntR 2.2e-12 32.8 61/64  
:BLT:SWISS 17->82 YVOA_BACSU 3e-08 36.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55214.1 GT:GENE BAD55214.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 386493..386885 GB:FROM 386493 GB:TO 386885 GB:DIRECTION + GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD55214.1 LENGTH 130 SQ:AASEQ MNHSTEEGELVLEDGKPLFLQIAEMIENSIIDGSLAEEAQAPSSNELAAFHRINPATAAKGLNQLVSEGILYKKRGIGMFVTAGARNALRMRRRERFAQQYIDPLIAEADKLGMGIDELKAMLDQREGSR GT:EXON 1|1-130:0| BL:SWS:NREP 1 BL:SWS:REP 17->82|YVOA_BACSU|3e-08|36.4|66/243| SEG 83->98|agarnalrmrrrerfa| BL:PDB:NREP 1 BL:PDB:REP 17->130|2ek5C|4e-24|50.4|113/117| RP:PDB:NREP 1 RP:PDB:REP 12->130|3by6D|9e-14|24.8|117/121| HM:PFM:NREP 1 HM:PFM:REP 21->81|PF00392|2.2e-12|32.8|61/64|GntR| RP:SCP:NREP 1 RP:SCP:REP 16->82|1e2xA1|8e-13|20.9|67/73|a.4.5.6| HM:SCP:REP 10->108|1v4rA1|3.4e-12|28.3|99/0|a.4.5.6|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 105 OP:NHOMOORG 98 OP:PATTERN -------------------------------------------------------------------- ----11111111-2----------------------11-1-1---1111---11-1-1-------1--------------1-------11---111----------------------------------------------------------------------------------------------------1-1111-1-1-1-21----111----2---------1--------------------1-1----1---1111---11---------------------------------------------------21--1111111-1-11------11-----1--22---112-------------------------------------------------------------------------------------------------------------------------------------11----------------------------------------------------------------------------------------------------------------------------------------1-----1----------1-1-11-----------------------------------------------------------------------------------------------------111111------------------------------------------------------------------1-----11---111111111---------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 129 STR:RPRED 99.2 SQ:SECSTR #HHHHHHHcccccccccHHHHHHHHHHHHHHTTcccTTcEEccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEETTTEEEEcTTccHHHHHHHHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHTcc DISOP:02AL 1-3, 8-12, 87-97, 129-130| PSIPRED cccccccccccccccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEccccEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccc //