[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55218.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:186 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   90->132 PF10825 * DUF2752 2e-05 46.5 %
:HMM:PFM   90->139 PF10825 * DUF2752 2.7e-20 38.0 50/52  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55218.1 GT:GENE BAD55218.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 389785..390345 GB:FROM 389785 GB:TO 390345 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55218.1 LENGTH 186 SQ:AASEQ MGYPAAIPIAADRYRVESTAATLGALAPVAAARLPWVLVDTPVDHQAPRPVQRGGLRALGLPMLTAAAGAGALVLLHVRDPHVEGSYGECPVYALFGVYCPGCGGMRAVHNLTDGRVLDSLHSNLLALPLIVAFFWFVADWSVRAWRGQKPRVPAIDRSVMWALFALFAVYAVLRNTPWGTWLTPV GT:EXON 1|1-186:0| TM:NTM 4 TM:REGION 20->42| TM:REGION 56->78| TM:REGION 122->144| TM:REGION 155->177| SEG 20->39|aatlgalapvaaarlpwvlv| SEG 58->76|alglpmltaaagagalvll| SEG 163->174|alfalfavyavl| RP:PFM:NREP 1 RP:PFM:REP 90->132|PF10825|2e-05|46.5|43/52|DUF2752| HM:PFM:NREP 1 HM:PFM:REP 90->139|PF10825|2.7e-20|38.0|50/52|DUF2752| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1111----------------------1---1-11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 45-55| PSIPRED cccccccccccHHHHHHHHHHHHHHHHHHHHHHccEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccc //