[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55220.1
DDBJ      :             putative peptidase
Swiss-Prot:             

Homologs  Archaea  22/68 : Bacteria  281/915 : Eukaryota  189/199 : Viruses  0/175   --->[See Alignment]
b.98.1d.92.1
:461 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   34->459 1z1wA PDBj 1e-23 26.6 %
:RPS:PDB   32->452 3ciaD PDBj 2e-58 23.0 %
:RPS:SCOP  18->213 1gw6A2  b.98.1.1 * 3e-24 17.9 %
:RPS:SCOP  207->452 1gw6A3  d.92.1.13 * 9e-41 26.4 %
:HMM:SCOP  17->214 1hs6A2 b.98.1.1 * 2.6e-35 27.2 %
:HMM:SCOP  223->451 1hs6A3 d.92.1.13 * 1.2e-54 31.4 %
:RPS:PFM   35->340 PF01433 * Peptidase_M1 6e-30 31.9 %
:HMM:PFM   88->343 PF01433 * Peptidase_M1 1.2e-39 26.5 253/391  
:BLT:SWISS 145->461 AMPE_HUMAN 3e-24 28.4 %
:PROS 302->311|PS00142|ZINC_PROTEASE

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55220.1 GT:GENE BAD55220.1 GT:PRODUCT putative peptidase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(390628..392013) GB:FROM 390628 GB:TO 392013 GB:DIRECTION - GB:PRODUCT putative peptidase GB:PROTEIN_ID BAD55220.1 LENGTH 461 SQ:AASEQ MRSADGREVLMGDKFYDEPIDDYLPQNGNRGYRVSRYELDLVYKVAGNRLSGRAEITAVTTAVRPRFAFDLAQSLSVAKVFVNGAKVARYTHRNGKLVLTPQQKIPAGGVLAVVVQYAGAPKPVRGPWGEVGWEELTEGALVASQPNGAASWFPCDDHPSSKASYRISITTDSPYHALANGTLVRKQTKASQTTWVYEQPEPMSSYLATIQIGPYRRHRIGSEQSPVPMYAVLPARLRAAFDTDFARQQRMMEVFTDLFGPYPFAGYTVVVTDDDLEIPIEAQGISIFGANHCDGRRGSERLVAHELAHQWFGNSLTLRRWRDIWLHEGFACYAEWIWSEAAGGPSADQLARAARHNLSREPQDLVLADPGPALMFDDRVYKRGALTLHALRIELGDRAFFDLLREWTGRYRHACVDTEEFTDLAGHYSQVPLRPLWDSWLRETALPPLPPHGGQAVTVPR GT:EXON 1|1-461:0| BL:SWS:NREP 1 BL:SWS:REP 145->461|AMPE_HUMAN|3e-24|28.4|310/957| PROS 302->311|PS00142|ZINC_PROTEASE|PDOC00129| BL:PDB:NREP 1 BL:PDB:REP 34->459|1z1wA|1e-23|26.6|399/780| RP:PDB:NREP 1 RP:PDB:REP 32->452|3ciaD|2e-58|23.0|409/582| RP:PFM:NREP 1 RP:PFM:REP 35->340|PF01433|6e-30|31.9|301/379|Peptidase_M1| HM:PFM:NREP 1 HM:PFM:REP 88->343|PF01433|1.2e-39|26.5|253/391|Peptidase_M1| GO:PFM:NREP 2 GO:PFM GO:0008237|"GO:metallopeptidase activity"|PF01433|IPR014782| GO:PFM GO:0008270|"GO:zinc ion binding"|PF01433|IPR014782| RP:SCP:NREP 2 RP:SCP:REP 18->213|1gw6A2|3e-24|17.9|196/208|b.98.1.1| RP:SCP:REP 207->452|1gw6A3|9e-41|26.4|231/252|d.92.1.13| HM:SCP:REP 17->214|1hs6A2|2.6e-35|27.2|195/208|b.98.1.1|1/1|Leukotriene A4 hydrolase N-terminal domain| HM:SCP:REP 223->451|1hs6A3|1.2e-54|31.4|229/252|d.92.1.13|1/1|Metalloproteases ("zincins"), catalytic domain| OP:NHOMO 1598 OP:NHOMOORG 492 OP:PATTERN ------21222222211211111--------------------------------------122--11 2231432122221131111-12112211111222223233-22211132221343234113351332B6611111111----------11-1-1--1--31632252423------------------1-1----111111---1-111-111--11------11121111-------------11--------------------------------------------------------------------111111111111111111111111111111111111111111111111111111111111--111---1-11-------------1------1------------------1-------1--311--1--1---------------------------------------------------11--------------------111-----------------------------------11-1-----------------------------------111----------------------------1-1-----------------1-1--1---211164-1-------------------------11---1111122-2333322233332323322---11----------------------------------------------------------------------------------------------211111------------------------111111--------------------------------1--------------11333332321111--1-111111------------------------------------------------- ----672-223-5534322333333333333332221323233232333433532334333335434134434354414332222222-322324211112214533333IDEB8EE6735595BA6E5P*E1D9M7657B4ABB76325A25H6A8897JKB99G8T7GRACAC22128---3124443242254552 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 443 STR:RPRED 96.1 SQ:SECSTR ################cEEGGGcccccccccEEEEEEEEEEEEETTTTEEEEEEEEEEEEcccccccEEEccccEEEEEEEEEcTTccEEEEEcccccEEEEEcccTTEccEEEEEEEEcTTcTTEEEEcGGGcccccccEEEEcTTTGGGTccccccTTccEEEEEEEEcccccEEEEccEEcccEEETTEcEEEEEEEEEEcGGGccEEEEccEEEEEcTTEccccEEEEEccTTHHHHHHHcTTHHHHHHHHHHHHcccTTccEEEEEccTTcccEEccTTEEEEcGGGccccccTTHHHHHHHHHTTcTTTEEEccTTcTHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHcccTTccTTTccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHTTTEEEcHHHHHHTTTTccccccHHHHHHHHHcccccccccccccEEEE## DISOP:02AL 1-10, 455-461| PSIPRED cccccccccccccccccccccccccccccccEEEEEEEEEEEEEccccEEEEEEEEEEEEcccccEEEEEccccEEEEEEEEccEEcccEEccccEEEEEEccccccccEEEEEEEEEccccccccccccccccccccEEEEEEccccccEEEEEccccccEEEEEEEEEEccccEEEEcccccccEEccccEEEEEEcccccccHHEEEEEEcEEEEEEcccccEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEcccccccccccEEEEccHHHccccHHHHHHHHHHHHHHHccEEEEccccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHcccccccccccHHHHcccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHcccccEEEEEcccEEEEEEc //