[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55222.1
DDBJ      :             putative translocator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  27/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:238 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   101->172 PF01810 * LysE 8e-09 44.8 %
:HMM:PFM   46->233 PF01810 * LysE 1.2e-30 27.2 184/192  
:BLT:SWISS 104->172 Y1627_SYNY3 2e-05 39.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55222.1 GT:GENE BAD55222.1 GT:PRODUCT putative translocator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(396166..396882) GB:FROM 396166 GB:TO 396882 GB:DIRECTION - GB:PRODUCT putative translocator GB:PROTEIN_ID BAD55222.1 LENGTH 238 SQ:AASEQ MADPAPRCQPRSPAHRNRVAGARGVRSHRQVTPSLLLSFVGLCVLLSLTPGPDSFLVLRFSIVDARPGIAAAIGSALGGIAWAVVVAAGVATLLEQSATAYRALKVIGGIYLVYLGIRALLDHRKQRGTAAEPPAADRHAPTVRSAFTAGVVSCLFNPKVGLFYLAVLPQFLTEVTFANTLALGAIECLVAAVEMVLLALLAARAVALLRTPRVRDRLEQASAAILTALGVGTVASAS GT:EXON 1|1-238:0| BL:SWS:NREP 1 BL:SWS:REP 104->172|Y1627_SYNY3|2e-05|39.7|63/206| TM:NTM 6 TM:REGION 36->58| TM:REGION 71->93| TM:REGION 101->123| TM:REGION 147->169| TM:REGION 185->207| TM:REGION 217->238| SEG 34->48|slllsfvglcvllsl| SEG 68->94|giaaaigsalggiawavvvaagvatll| SEG 189->209|lvaavemvllallaaravall| RP:PFM:NREP 1 RP:PFM:REP 101->172|PF01810|8e-09|44.8|67/190|LysE| HM:PFM:NREP 1 HM:PFM:REP 46->233|PF01810|1.2e-30|27.2|184/192|LysE| GO:PFM:NREP 2 GO:PFM GO:0006865|"GO:amino acid transport"|PF01810|IPR001123| GO:PFM GO:0016020|"GO:membrane"|PF01810|IPR001123| OP:NHOMO 27 OP:NHOMOORG 27 OP:PATTERN -------------------------------------------------------------------- ------------------------------------111------------------1--------1-------------------------------------------------------------------------------------------------------------------------------11111-11--1---1------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------1-----------1----------------------------1--------------------------------------------1----1-------------------------------------1--------------------------------1----------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------111------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-18, 123-144| PSIPRED cccccccccccccHHcccccccccccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //