[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55226.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:84 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   53->78 1z8hD PDBj 7e-04 50.0 %
:HMM:PFM   5->58 PF12071 * DUF3551 0.00013 34.6 52/82  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55226.1 GT:GENE BAD55226.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 400235..400489 GB:FROM 400235 GB:TO 400489 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55226.1 LENGTH 84 SQ:AASEQ MRIKSLIAAGLLATAAVAGVSTAATASAAAPIETTYQAAYYGGTYIGTYATLEACRADGISPSTGGYYWECIENWDGWDLYIYY GT:EXON 1|1-84:0| TM:NTM 1 TM:REGION 6->28| SEG 8->30|aagllataavagvstaatasaaa| SEG 34->51|ttyqaayyggtyigtyat| BL:PDB:NREP 1 BL:PDB:REP 53->78|1z8hD|7e-04|50.0|26/200| HM:PFM:NREP 1 HM:PFM:REP 5->58|PF12071|0.00013|34.6|52/82|DUF3551| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED ccHHHHHHHHHHHHHHHHcccccccccccccccccEEEEEcccEEEHHHHHHHHHHccccccccccEEEEEEcccccEEEEEEc //