[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55234.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  689/915 : Eukaryota  7/199 : Viruses  0/175   --->[See Alignment]
a.4.5c.94.1
:298 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->76 1iz1B PDBj 7e-13 43.7 %
:BLT:PDB   91->244 1i6aA PDBj 2e-04 25.0 %
:RPS:PDB   1->189 1bi3A PDBj 1e-21 14.0 %
:RPS:SCOP  1->101 1b9mA1  a.4.5.8 * 3e-21 13.9 %
:RPS:SCOP  91->286 1i69A  c.94.1.1 * 5e-17 23.4 %
:HMM:SCOP  3->91 1ixcA1 a.4.5.37 * 7.2e-24 47.2 %
:HMM:SCOP  85->281 2fyiA1 c.94.1.1 * 7.6e-23 28.1 %
:RPS:PFM   5->64 PF00126 * HTH_1 8e-12 58.3 %
:RPS:PFM   133->235 PF03466 * LysR_substrate 4e-04 33.7 %
:HMM:PFM   86->277 PF03466 * LysR_substrate 9.1e-32 27.4 190/209  
:HMM:PFM   5->64 PF00126 * HTH_1 4.8e-27 56.7 60/60  
:BLT:SWISS 5->238 GLTC_BACSU 7e-27 34.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55234.1 GT:GENE BAD55234.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(410813..411709) GB:FROM 410813 GB:TO 411709 GB:DIRECTION - GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD55234.1 LENGTH 298 SQ:AASEQ MDPHLRDLRYFVAVAEELHFTNAAQRLHIAQPTLSRQIRQLERQLDVVLFDRNQRSVALTVAGKELLEGARKILELWEVTNVSLQEAGEVLRVGIQSALGRGLLNDLESASGYRLALHAASWNDPSSGLAGRQADLALVWLPLPDSNRYRWQVLRTEPRWVLLPENHPLAGQDVIDFADLMDEPFIALPAEAGAMRDFWLGNDGRGGRAPKIGAEAATPEDKLEAVSLGLGVCLLAENNVPMYRWPGLTARPVGGLAPCELAVAWRADDTRPTILEFAGRAMEGGFATLQQQHQPVAS GT:EXON 1|1-298:0| BL:SWS:NREP 1 BL:SWS:REP 5->238|GLTC_BACSU|7e-27|34.1|232/300| BL:PDB:NREP 2 BL:PDB:REP 6->76|1iz1B|7e-13|43.7|71/294| BL:PDB:REP 91->244|1i6aA|2e-04|25.0|152/212| RP:PDB:NREP 1 RP:PDB:REP 1->189|1bi3A|1e-21|14.0|186/211| RP:PFM:NREP 2 RP:PFM:REP 5->64|PF00126|8e-12|58.3|60/60|HTH_1| RP:PFM:REP 133->235|PF03466|4e-04|33.7|101/207|LysR_substrate| HM:PFM:NREP 2 HM:PFM:REP 86->277|PF03466|9.1e-32|27.4|190/209|LysR_substrate| HM:PFM:REP 5->64|PF00126|4.8e-27|56.7|60/60|HTH_1| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00126|IPR000847| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00126|IPR000847| RP:SCP:NREP 2 RP:SCP:REP 1->101|1b9mA1|3e-21|13.9|101/122|a.4.5.8| RP:SCP:REP 91->286|1i69A|5e-17|23.4|188/206|c.94.1.1| HM:SCP:REP 3->91|1ixcA1|7.2e-24|47.2|89/0|a.4.5.37|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 85->281|2fyiA1|7.6e-23|28.1|196/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 4379 OP:NHOMOORG 697 OP:PATTERN ------------------------------------1------------------------------- 442-F1-3665412B5511-15222J1111126555BHNQ-B4821-2-21-4732-5--2421A4NEI93-222112-1574--1-12221-1------1811211215---------------1--------1-45513---215335335332211111123366461111111111111122-----53B77777687475867621879A7672337131444433GS-2222222222222233326423464313127744543231-22-11111-----------------111111--11111--11111112-21761112132122152211114----324--9B33231221211---311243321111132ABF-376865544544454457-23633N7C9C31H77B47AEK9FFEF32146B54675885455555574552254------------------------------28B32AXRKSVWWbYWECCCCTTaUFFFEBFbMbJVVR-1KGDA98A6VAI5VB7A64111D611111-11233472-11--2--27225-2-133521-543466-2--2------------------1---76E88464544475555513553446357476--11337------B7E96AABBA9B989BA-BAABB88AAAB9B99AA99HJGAF667C7C8CBCCCBC9B98CD68777774-644455435555---2111114534137AH3342141121221129998948354H5JLNKKRLTCMQMJ4ABE---------436597777736444768999A55532221-4211------------1-------------------------------------151 -------------3------------------------------------------------------------------------------------------------------------------------------------------------5-----------5--2-1------------5-----3---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 275 STR:RPRED 92.3 SQ:SECSTR HHHHHHHHHHHHHHTccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEEcTTccEEEcHHHHHHHHHHHHHHHHHHHHHHHTTcccHHHHHHHccHHHHHHHHHHcccccccTTccccTTHHHHTcccEEHHHHcccccEEEEEEEEccGGGccccTHHHHHHHTTccTTcEEEEccccEEEETTEETTEEEEccHHHHGGGcTTccTTcEEEEccHHHHHHHHHHTccEEEEEGGGccTTTcTTcEEEEccTcccEEEEEEEETTccccHHH####################### DISOP:02AL 289-298| PSIPRED ccccHHHHHHHHHHHHcccHHHHHHHHcccccHHHHHHHHHHHHHccEEEEEccccEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHcccEEEEEEEccccccccEEEEEEEcccEEEEEcccccccccccccHHHHccccEEEEcccccHHHHHHHHHHHHccccEEEEEEEcHHHHHHHHHHccccHHHHHHHHHHHcccccEEEEEccccccEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHcccccccc //