[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55237.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:87 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->33 PF10041 * DUF2277 1e-05 69.7 %
:HMM:PFM   1->83 PF10041 * DUF2277 1.1e-33 53.2 77/78  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55237.1 GT:GENE BAD55237.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(415195..415458) GB:FROM 415195 GB:TO 415458 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55237.1 LENGTH 87 SQ:AASEQ MCSDITRLRGLEPAATEQEIYAAALQYVRKVGGVSGLSTTTKAAVDKAVATIAAATTTLLAELPDHPAADGVEPPLRRNRVREVVTD GT:EXON 1|1-87:0| SEG 39->61|tttkaavdkavatiaaatttlla| RP:PFM:NREP 1 RP:PFM:REP 1->33|PF10041|1e-05|69.7|33/78|DUF2277| HM:PFM:NREP 1 HM:PFM:REP 1->83|PF10041|1.1e-33|53.2|77/78|DUF2277| OP:NHOMO 4 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- --------------1---------------------2------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 66-77, 82-87| PSIPRED ccccccccccccccccHHHHHHHHHHHHHHHHccccHHHccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHcc //