[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55245.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:157 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   31->106 PF11377 * DUF3180 5e-06 36.8 %
:HMM:PFM   11->148 PF11377 * DUF3180 6.3e-42 48.9 135/138  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55245.1 GT:GENE BAD55245.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 422703..423176 GB:FROM 422703 GB:TO 423176 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55245.1 LENGTH 157 SQ:AASEQ MKLKPTKALDLVANVLIAALLAWAATRFAYGSLPPISVFAGASLYPVAALEVVLAFVIRARVRNEEVGTGRKLHPITAARAVALAKASVQVGSIAAGIWLGFLCWVFPQRGTLTAAAADAPGAIVGLSAGVALVAAALWLEYCCRAPDDPTDETATT GT:EXON 1|1-157:0| TM:NTM 4 TM:REGION 5->27| TM:REGION 37->59| TM:REGION 80->102| TM:REGION 120->142| SEG 8->25|aldlvanvliaallawaa| SEG 78->87|aaravalaka| SEG 115->138|aaaadapgaivglsagvalvaaal| SEG 146->156|apddptdetat| RP:PFM:NREP 1 RP:PFM:REP 31->106|PF11377|5e-06|36.8|76/141|DUF3180| HM:PFM:NREP 1 HM:PFM:REP 11->148|PF11377|6.3e-42|48.9|135/138|DUF3180| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- ---------------11-------------------1111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 145-157| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccc //