[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55250.1
DDBJ      :             hypothetical protein
Swiss-Prot:COAX_NOCFA   RecName: Full=Type III pantothenate kinase;         EC=2.7.1.33;AltName: Full=Pantothenic acid kinase;AltName: Full=PanK-III;

Homologs  Archaea  0/68 : Bacteria  370/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.55.1
:264 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->258 2h3gX PDBj 3e-54 46.1 %
:RPS:PDB   1->259 3djcC PDBj 2e-69 40.4 %
:RPS:SCOP  1->124 2gtdA1  c.55.1.13 * 3e-11 30.5 %
:RPS:SCOP  126->254 2f9tA1  c.55.1.13 * 4e-33 31.9 %
:HMM:SCOP  1->124 2gtdA1 c.55.1.13 * 1.4e-30 46.6 %
:HMM:SCOP  125->257 2gtdA2 c.55.1.13 * 1.6e-35 50.8 %
:RPS:PFM   2->207 PF03309 * Bvg_acc_factor 1e-42 54.3 %
:HMM:PFM   2->206 PF03309 * Bvg_acc_factor 3.9e-60 48.5 198/206  
:BLT:SWISS 1->264 COAX_NOCFA e-149 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55250.1 GT:GENE BAD55250.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 427394..428188 GB:FROM 427394 GB:TO 428188 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55250.1 LENGTH 264 SQ:AASEQ MLLTIDVRNTSIELGLFAGSGTHARLERHWRIHTNPLLTADELAMQLRGLIGGPLEQVIGVAALSTVPPVLRELRTMLARYWSHVPHVVVEPGVRTGIPLLVDNPKEIGADRIVNALAAHQRFGGPAIVVDFGTATTVDLVSAKGEFLGGVIAPGVAISGEALIEKAGLRRVELARPRSVVGKNTVEAIQSGAVFGFAGLVDGLIDRIRDEFDAFAGDDVTVVATGISAPLIVPESETIDQHEPHLTLTGLLRVYERNQQRRRT GT:EXON 1|1-264:0| SW:ID COAX_NOCFA SW:DE RecName: Full=Type III pantothenate kinase; EC=2.7.1.33;AltName: Full=Pantothenic acid kinase;AltName: Full=PanK-III; SW:GN Name=coaX; OrderedLocusNames=NFA_4080; SW:KW ATP-binding; Coenzyme A biosynthesis; Complete proteome; Cytoplasm;Kinase; Metal-binding; Nucleotide-binding; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->264|COAX_NOCFA|e-149|100.0|264/264| GO:SWS:NREP 7 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0015937|"GO:coenzyme A biosynthetic process"|Coenzyme A biosynthesis| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| BL:PDB:NREP 1 BL:PDB:REP 1->258|2h3gX|3e-54|46.1|243/247| RP:PDB:NREP 1 RP:PDB:REP 1->259|3djcC|2e-69|40.4|250/256| RP:PFM:NREP 1 RP:PFM:REP 2->207|PF03309|1e-42|54.3|199/203|Bvg_acc_factor| HM:PFM:NREP 1 HM:PFM:REP 2->206|PF03309|3.9e-60|48.5|198/206|Bvg_acc_factor| GO:PFM:NREP 2 GO:PFM GO:0016563|"GO:transcription activator activity"|PF03309|IPR004619| GO:PFM GO:0045941|"GO:positive regulation of transcription"|PF03309|IPR004619| RP:SCP:NREP 2 RP:SCP:REP 1->124|2gtdA1|3e-11|30.5|118/118|c.55.1.13| RP:SCP:REP 126->254|2f9tA1|4e-33|31.9|119/125|c.55.1.13| HM:SCP:REP 1->124|2gtdA1|1.4e-30|46.6|118/0|c.55.1.13|1/1|Actin-like ATPase domain| HM:SCP:REP 125->257|2gtdA2|1.6e-35|50.8|126/0|c.55.1.13|1/1|Actin-like ATPase domain| OP:NHOMO 387 OP:NHOMOORG 370 OP:PATTERN -------------------------------------------------------------------- 11111---------11111-111111111111111111111111----------------111-1111111111111111211--1111111-111---1-1--1-1211---------------11111111111---1111111---1-----11--------11----------------11111111-11111111111111111111111111111111111111111------------------------------------------------------------------------------------------11111111111111111111111111212112111121111111111111-211111--------------------------------------------------------1111111111111111111111--111111111-111---------------------111111-------------------1-----11-1---------11-111111111-11--1-1111111111111-11111111111111111111111111111111-------------------------11--------------------------------111-1--------------------------------------------------------------------------------------------------1111-1-11-------------------------1-----1-111111111-1222222222---------------11--------------1-111111-1111111-11----------------1--------1111111111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 259 STR:RPRED 98.1 SQ:SECSTR cEEEEEEcccEEEEEEEETTcEEcEEEEEEEEEEcccccHHHHHHHHHHHHTccGGGccEEEEEEccTTTHHHHHHHHHHHTcccccEEccTTcccccEEccccTTcccHHHHHHHHHHHHHcTTcEEEEEEccEEEEEEEcTTcEEEEEEEEEcHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcTcTTccEEEEEEEccGGGGTTTTTcccEEcTTHHHHHHHHHHHTTc##### DISOP:02AL 259-264| PSIPRED cEEEEEEcccEEEEEEEEcccccEEEEEccEEcccccccHHHHHHHHHHHccccccHHcEEEEEEccHHHHHHHHHHHHHHHccccEEEEccHHHccccccccccHHHHHHHHHHHHHHHHHccccEEEEEcHHHHEEHEEcccccEEEEEHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEcccHHHHHHHccccEEEcccHHHHHHHHHHHHccccccc //