[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55251.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  32/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.82.1
:185 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   24->166 2ic1A PDBj 4e-04 23.4 %
:RPS:PDB   38->150 2d5hC PDBj 3e-08 13.3 %
:RPS:SCOP  38->182 2atfA1  b.82.1.19 * 9e-09 17.1 %
:HMM:SCOP  7->186 2b5hA1 b.82.1.19 * 5.4e-22 28.7 %
:RPS:PFM   62->158 PF05995 * CDO_I 7e-10 39.6 %
:HMM:PFM   18->164 PF05995 * CDO_I 5e-37 36.9 141/175  
:BLT:SWISS 65->163 CDOA_BACSU 2e-07 34.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55251.1 GT:GENE BAD55251.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 428447..429004 GB:FROM 428447 GB:TO 429004 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55251.1 LENGTH 185 SQ:AASEQ MLTPDDARLERAVAPALPTRLRPADLLRLTDEGAEDVLDGRYDHLLPAGGAWPTEERWATRLRADDEVDVWLISWTPAKTTELHDHAGSLGALTVLSGALSELRWTGTELRARTLSAGDQAAFPIGWVHEVMRAPAAIEPVTAEPTLSVHAYSPPLTAMSYYEITGQGTLRRTRTVLTDEPEGDI GT:EXON 1|1-185:0| BL:SWS:NREP 1 BL:SWS:REP 65->163|CDOA_BACSU|2e-07|34.8|92/161| BL:PDB:NREP 1 BL:PDB:REP 24->166|2ic1A|4e-04|23.4|141/185| RP:PDB:NREP 1 RP:PDB:REP 38->150|2d5hC|3e-08|13.3|113/369| RP:PFM:NREP 1 RP:PFM:REP 62->158|PF05995|7e-10|39.6|91/155|CDO_I| HM:PFM:NREP 1 HM:PFM:REP 18->164|PF05995|5e-37|36.9|141/175|CDO_I| GO:PFM:NREP 4 GO:PFM GO:0005506|"GO:iron ion binding"|PF05995|IPR010300| GO:PFM GO:0017172|"GO:cysteine dioxygenase activity"|PF05995|IPR010300| GO:PFM GO:0046439|"GO:L-cysteine metabolic process"|PF05995|IPR010300| GO:PFM GO:0055114|"GO:oxidation reduction"|PF05995|IPR010300| RP:SCP:NREP 1 RP:SCP:REP 38->182|2atfA1|9e-09|17.1|140/186|b.82.1.19| HM:SCP:REP 7->186|2b5hA1|5.4e-22|28.7|167/0|b.82.1.19|1/1|RmlC-like cupins| OP:NHOMO 37 OP:NHOMOORG 32 OP:PATTERN -------------------------------------------------------------------- ----1---------11111-11--1111111111111111-11-1-------------------2-2222----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 174 STR:RPRED 94.1 SQ:SECSTR ######ccccHHHHccEEcHHHHEEEEEEETTEEEEEcTTcccEEETTTEEEEEEcTTTcTTHHHHccEEEEEEEcTTcEEEEEEEccccEEEEEEEEEEEEEEcTccccEEEEEETTcEEEEcTTcEEEEEEEEEEEEEEccTTccEEEHccHHHHHHHHEcTTTccEEEEEccccEET##### DISOP:02AL 1-4, 10-18, 175-185| PSIPRED ccccHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEEccccEEEEEEEccccccccccccccHHHHHHHHHHHHHHEEEcccccccEEEccccEEEEcHHHHHHHHcccccccccccccEEEEEEEcccccccEEcccccccccEEEEEEEEEcccccc //