[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55254.1
DDBJ      :             putative LSR2 protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  55/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:120 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->117 PF11774 * Lsr2 1e-17 57.3 %
:HMM:PFM   1->117 PF11774 * Lsr2 1.9e-47 60.2 108/110  
:BLT:SWISS 1->117 LSR2_MYCLE 3e-30 73.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55254.1 GT:GENE BAD55254.1 GT:PRODUCT putative LSR2 protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 431142..431504 GB:FROM 431142 GB:TO 431504 GB:DIRECTION + GB:PRODUCT putative LSR2 protein GB:PROTEIN_ID BAD55254.1 LENGTH 120 SQ:AASEQ MAKKVTVSLIDDVDGESIADETIEFAIDGVSYEIDLSAANAAKLRDGLEQWVSNARRVSGRRRAKAATTGASATPKSRVSIDREQSAAIREWARRNGHKVSARGRISADITEAYNKAAKG GT:EXON 1|1-120:0| BL:SWS:NREP 1 BL:SWS:REP 1->117|LSR2_MYCLE|3e-30|73.9|111/112| SEG 59->77|sgrrrakaattgasatpks| RP:PFM:NREP 1 RP:PFM:REP 1->117|PF11774|1e-17|57.3|110/110|Lsr2| HM:PFM:NREP 1 HM:PFM:REP 1->117|PF11774|1.9e-47|60.2|108/110|Lsr2| OP:NHOMO 96 OP:NHOMOORG 56 OP:PATTERN -------------------------------------------------------------------- -----1------1111111-1211111111111111338311153211123-231111--331-2232214---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------ DISOP:02AL 59-87, 118-120| PSIPRED cccEEEEEEEEcccccccccEEEEEEEccEEEEEEccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHcc //