[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55255.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  15/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.4.1a.4.6b.26.1
:207 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   16->98 2jqjA PDBj 4e-08 44.4 %
:BLT:PDB   123->185 1zlkA PDBj 7e-04 37.7 %
:RPS:PDB   6->103 2affA PDBj 1e-18 22.3 %
:RPS:PDB   126->201 3cloA PDBj 6e-10 23.3 %
:RPS:SCOP  7->121 2pieA1  b.26.1.2 * 6e-18 21.2 %
:RPS:SCOP  121->177 1tc3C  a.4.1.2 * 1e-05 20.8 %
:RPS:SCOP  152->202 1fseF  a.4.6.2 * 8e-10 17.8 %
:HMM:SCOP  7->127 1g3gA_ b.26.1.2 * 3.4e-21 33.3 %
:HMM:SCOP  104->206 1p4wA_ a.4.6.2 * 1.7e-07 31.0 %
:RPS:PFM   30->96 PF00498 * FHA 1e-09 50.8 %
:HMM:PFM   30->96 PF00498 * FHA 7e-20 46.2 65/68  
:HMM:PFM   151->185 PF00196 * GerE 4e-10 34.3 35/58  
:BLT:SWISS 19->102 FRAH_ANASP 8e-09 47.6 %
:BLT:SWISS 151->185 CSGD_SALTY 1e-04 51.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55255.1 GT:GENE BAD55255.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 431689..432312 GB:FROM 431689 GB:TO 432312 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55255.1 LENGTH 207 SQ:AASEQ MTGFVGSLLRYTDDAGRQQEFELTPERQRITIGRSPQADLSLSWDAEVSRLHAAVEYLGAHWTIVDDGLSRNGTFVNGERLVGRHRLQPGDRIRVGSSLVSFHEFGTPAEDITRVATGSIPTLRSLTETQRAVLVALCRPYKNGAGFATPASNQQIADELFLSVDAIKTHLRALFAKFGVENLPQNQKRVRLAALAMQSGIISDRDL GT:EXON 1|1-207:0| BL:SWS:NREP 2 BL:SWS:REP 19->102|FRAH_ANASP|8e-09|47.6|82/289| BL:SWS:REP 151->185|CSGD_SALTY|1e-04|51.4|35/216| BL:PDB:NREP 2 BL:PDB:REP 16->98|2jqjA|4e-08|44.4|81/141| BL:PDB:REP 123->185|1zlkA|7e-04|37.7|53/65| RP:PDB:NREP 2 RP:PDB:REP 6->103|2affA|1e-18|22.3|94/98| RP:PDB:REP 126->201|3cloA|6e-10|23.3|60/249| RP:PFM:NREP 1 RP:PFM:REP 30->96|PF00498|1e-09|50.8|65/68|FHA| HM:PFM:NREP 2 HM:PFM:REP 30->96|PF00498|7e-20|46.2|65/68|FHA| HM:PFM:REP 151->185|PF00196|4e-10|34.3|35/58|GerE| RP:SCP:NREP 3 RP:SCP:REP 7->121|2pieA1|6e-18|21.2|113/127|b.26.1.2| RP:SCP:REP 121->177|1tc3C|1e-05|20.8|48/51|a.4.1.2| RP:SCP:REP 152->202|1fseF|8e-10|17.8|45/50|a.4.6.2| HM:SCP:REP 7->127|1g3gA_|3.4e-21|33.3|117/164|b.26.1.2|1/1|SMAD/FHA domain| HM:SCP:REP 104->206|1p4wA_|1.7e-07|31.0|87/0|a.4.6.2|1/1|C-terminal effector domain of the bipartite response regulators| OP:NHOMO 19 OP:NHOMOORG 16 OP:PATTERN -------------------------------------------------------------------- --1-----------------------------11111-22-1----------------------------1--------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------2--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 197 STR:RPRED 95.2 SQ:SECSTR #####EEEEEEcTTccEEEEEEccccccEEEEEccTTccEEccccTTcccccEEEEEccccEEEEEccccccccEETTEEccccEEEcTTcEEEETTEEEEEEcccEEEEEHHHcccccccccccccccccEHHHHHHTTcHHHHHHHTTccHHHHHHHHTccHHHHHHHHHHHHHHTTccccccTTEHHHHHHHHHHTccT##### DISOP:02AL 109-136, 149-153, 206-207| PSIPRED cccEEEEEEEEcccccccEEEEEEccccEEEEcccccccEEEccccccccEEEEEEEEccEEEEEEcccccccEEEccEEccccEEEccccEEEEccEEEEEEEcccccccccccccccccccHHHHHHHHHHHHHHcccccccHHHcccccccHHHHHHcccHHHHccccHHHHHHHccccHHHHHHHHHHHHHHHEEEEEccccc //