[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55256.1
DDBJ      :             putative membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:182 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   21->157 PF08592 * DUF1772 1.1e-25 27.4 135/139  
:PROS 67->78|PS00962|RIBOSOMAL_S2_1
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55256.1 GT:GENE BAD55256.1 GT:PRODUCT putative membrane protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 432513..433061 GB:FROM 432513 GB:TO 433061 GB:DIRECTION + GB:PRODUCT putative membrane protein GB:PROTEIN_ID BAD55256.1 LENGTH 182 SQ:AASEQ MVALRIAALVAAVLTTGLIAGVFYAYAISVMPALAGTDDRTIVEVMQKVNVAILNPWFLVPFVGTVACTVLAAALHLGGAQRTTLVWILVALVLDIAAFAVTAGLNVPLNERLAAAGDPAAIVDPAAVRAGFEAAWVRYNIGRAVLHTLAFLVLCGALVSAGAARAEAAPVTHSAGAVSAGV GT:EXON 1|1-182:0| PROS 67->78|PS00962|RIBOSOMAL_S2_1|PDOC00744| TM:NTM 4 TM:REGION 8->30| TM:REGION 52->74| TM:REGION 85->107| TM:REGION 144->165| SEG 2->20|valriaalvaavlttglia| HM:PFM:NREP 1 HM:PFM:REP 21->157|PF08592|1.1e-25|27.4|135/139|DUF1772| OP:NHOMO 13 OP:NHOMOORG 13 OP:PATTERN -------------------------------------------------------------------- ----1-------------------------------1--------1--------------------1111-----------------------------------1-1----------------------------------------------------------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 167-182| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHEEcccHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHcccccccc //