[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55258.1
DDBJ      :             putative DNA-binding protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  53/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
a.35.1
:103 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   30->95 2a6cA PDBj 3e-10 45.3 %
:RPS:PDB   17->90 2ao9A PDBj 3e-08 9.5 %
:RPS:SCOP  28->95 2a6cA1  a.35.1.13 * 8e-22 44.1 %
:HMM:SCOP  27->93 2a6cA1 a.35.1.13 * 9.2e-12 32.8 %
:HMM:PFM   37->89 PF01381 * HTH_3 1.5e-09 32.7 52/55  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55258.1 GT:GENE BAD55258.1 GT:PRODUCT putative DNA-binding protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(436086..436397) GB:FROM 436086 GB:TO 436397 GB:DIRECTION - GB:PRODUCT putative DNA-binding protein GB:PROTEIN_ID BAD55258.1 LENGTH 103 SQ:AASEQ MKEHQEQQEFASVFDALADTPAESENLKVRSQLMRAIRDRIDEFGWSQRVAATNLGVTQPRISDLKNGKMSRFSVDTLVNLAAKVGLTVEVRIVDTRTVDAPA GT:EXON 1|1-103:0| BL:PDB:NREP 1 BL:PDB:REP 30->95|2a6cA|3e-10|45.3|64/72| RP:PDB:NREP 1 RP:PDB:REP 17->90|2ao9A|3e-08|9.5|74/117| HM:PFM:NREP 1 HM:PFM:REP 37->89|PF01381|1.5e-09|32.7|52/55|HTH_3| RP:SCP:NREP 1 RP:SCP:REP 28->95|2a6cA1|8e-22|44.1|68/69|a.35.1.13| HM:SCP:REP 27->93|2a6cA1|9.2e-12|32.8|67/0|a.35.1.13|1/1|lambda repressor-like DNA-binding domains| OP:NHOMO 62 OP:NHOMOORG 54 OP:PATTERN -------------------------------------------------------------------- --1-----------1------1--------------1--2--------------------------------------------------------------------1-------------------------------------1-----1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111----------------------1----------1---------------------------1-----1------------------------------------------11111---------------1---------------------2--2------11-----3111-----------------------1------------------------------------1---------------------------------------------------11--1-----1---1---1-111-------1----1--------------------1-------------------------------------------------------------1------11-------11--------------1--------1-----------22-2----------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 87 STR:RPRED 84.5 SQ:SECSTR ################HHHHHTTccHHHHHHHHHHHHHHHcccccccHHHHHHHHTccHHHHHHHHHHcHHHHHHHHHHHHHHHHTTHHHHHHHTTTTTTccc DISOP:02AL 1-11, 94-103| PSIPRED ccccccccccccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHccccHHHHHHHHcccccccHHHHHHHHHHccccEEEEEEccccccccc //