[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55259.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  29/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:70 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   5->58 PF05973 * Gp49 8e-10 44.4 %
:HMM:PFM   4->57 PF05973 * Gp49 9.2e-19 40.7 54/91  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55259.1 GT:GENE BAD55259.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(436394..436606) GB:FROM 436394 GB:TO 436606 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55259.1 LENGTH 70 SQ:AASEQ MHSVGKGVREIRVAEDDGWFRVFYVADLGDVVYILHGFQKKSNQTPKRAVETGINRYRLAVAESQQRVQR GT:EXON 1|1-70:0| TM:NTM 1 TM:REGION 18->39| RP:PFM:NREP 1 RP:PFM:REP 5->58|PF05973|8e-10|44.4|54/92|Gp49| HM:PFM:NREP 1 HM:PFM:REP 4->57|PF05973|9.2e-19|40.7|54/91|Gp49| OP:NHOMO 33 OP:NHOMOORG 29 OP:PATTERN -------------------------------------------------------------------- --1-----------1---------------------1--1----------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------1--------------------------------------1------------------------------------------------11111---------------1------------------------2---------------11----------------------------------------------------------------------------------------------------------------11--1-1---1-------1-111----------------------------------------------------------------------------------------------------------------------------------------------------22-2----------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 62-70| PSIPRED cccccccEEEEEEEcccccEEEEEEEEEccEEEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHcccc //