[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55262.1
DDBJ      :             putative ABC transporter ATP-binding protein
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  906/915 : Eukaryota  197/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:299 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   6->218 1vplA PDBj 4e-35 39.9 %
:RPS:PDB   1->203 2dwoA PDBj 1e-38 7.3 %
:RPS:SCOP  4->217 1b0uA  c.37.1.12 * 4e-42 26.6 %
:HMM:SCOP  10->209 1ii8.1 c.37.1.12 * 6e-57 37.9 %
:RPS:PFM   45->159 PF00005 * ABC_tran 6e-14 38.1 %
:HMM:PFM   45->159 PF00005 * ABC_tran 1.3e-20 37.2 113/118  
:BLT:SWISS 3->211 BCRA_BACLI 4e-52 50.2 %
:PROS 131->145|PS00211|ABC_TRANSPORTER_1
:REPEAT 2|71->148|162->226
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55262.1 GT:GENE BAD55262.1 GT:PRODUCT putative ABC transporter ATP-binding protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 438808..439707 GB:FROM 438808 GB:TO 439707 GB:DIRECTION + GB:PRODUCT putative ABC transporter ATP-binding protein GB:PROTEIN_ID BAD55262.1 LENGTH 299 SQ:AASEQ MTNSIVVTSGLTKRYGEHTAVDDVGMRVAAGEVYGFLGPNGAGKTTTLRMLAGLIRPSAGTATVLGGAPGDPAVLRRIGVLIEGPGFYPYLSGRENLRVLARYRGLGRAEVDEALDRVGLTARGGDRFRTYSLGMKQRLGVGAALLGRPNLLILDEPTNGLDPAGMAEMRALIAGLAGEGHTVLLSSHLLSEVQEICDRVGVIANGRLVTESTVAELRGGAALFVRAEPWETALSAVRGIAGTVRRAGEGIRIDAPADAAPDVARAVVAAGADLLELRVDEKSLEEVFFEITGTEGALR GT:EXON 1|1-299:0| BL:SWS:NREP 1 BL:SWS:REP 3->211|BCRA_BACLI|4e-52|50.2|209/306| PROS 131->145|PS00211|ABC_TRANSPORTER_1|PDOC00185| NREPEAT 1 REPEAT 2|71->148|162->226| SEG 250->273|giridapadaapdvaravvaagad| BL:PDB:NREP 1 BL:PDB:REP 6->218|1vplA|4e-35|39.9|213/238| RP:PDB:NREP 1 RP:PDB:REP 1->203|2dwoA|1e-38|7.3|191/449| RP:PFM:NREP 1 RP:PFM:REP 45->159|PF00005|6e-14|38.1|113/123|ABC_tran| HM:PFM:NREP 1 HM:PFM:REP 45->159|PF00005|1.3e-20|37.2|113/118|ABC_tran| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 4->217|1b0uA|4e-42|26.6|214/258|c.37.1.12| HM:SCP:REP 10->209|1ii8.1|6e-57|37.9|198/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 42853 OP:NHOMOORG 1171 OP:PATTERN UUHAOLFJPQQNOMRJgIOMMLOUsQUfiXdSE8B8A9FEDB8SWKXXKL*nd7MYMTVINEIBT175 PWyO*bcfkklXbUXVaPO-OmBBZ*OPPOPQvuqwz***U*i*t**iosiO**xRSeEE***j*y****hVVVVxbYUMubmA6957NNNK4JDDC--BDKEFFWHQTO34444447789999BOMEMQFJRNPKmkky*HHGwefYfqVVfXeRTJDGFHFUdTitsuNCM9BEAAKBCABhbcVRYP6Ubs********o*******w**rs***ajn*udlkopkkm**SXXYYYUWWWXXXVWQRNVUhTWQstONRNTnnJKxzWQPUaWRTUedfjhdlmikijhjgiflhjhTSTSRTTTVTTSSqdfXWXhfiea*gy*uuu**vwcvYlorrURTP*dcbX*diVJ**ghZXdcRaXPXXJIKYIeWVVOIIFHIea***YRu****************-pq*mi*q***O9**************FMK**********ONOOOOOO*cfLPoc*66445333222344445443334467454HFGFDB***************z********r********9N**v*mvlr******UilMSIMlVHHGHGHGNOPbrkYt*SUSqiSlreanJbeZOUYiSYgdcis*W*BFGJABBCDAB786776766BL79BMLmloLnYRGSGjPPQRQKRYQPPOPQWRQUT5-ALSPL-1-111*y**U*rquutrvryps-tqptvrutrsuxrpppppn*****beWjhhijkkkljhiliii*jhfmmkmR3************22EGCDCDDGFFGOIun*TTTUQRFMNKJPKOWLMMMMFPCHNrZyxrxw***s**yyl***D98789A89IYfemfgfhfmvkjkUUTPQQPPRQHHHH23LOONFFGG66666666lAH6553A-5562886676579743445PfaKNXpXfVCgM 1122XTE-MC4FJRLA7A499CBEAEBA84434B776655666556777BCFDBDGE4876872432212335752416557349814-7A5775511325278DB2RnWSJQOTRSEDC7IJJfh8hC**c4dLgGGH9UDEVKBFECERFB*COLIkAKtGaIZAsSV*LSMBBDCA*9A6IOhOM*6maFBsYiqY ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 296-299| PSIPRED ccccEEEEEEEEEEEccEEEEEccEEEEcccEEEEEEccccccHHHHHHHHHHcccccccEEEEEcccccHHHHHHHcccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHcccHHHHccHHHHcccHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHccEEEEEccEEEEEccHHHHHcccEEEEEEcccHHHHHHHcccccEEEEcccEEEEEEccHHHHHHHHHHHHccccEEEEEEEcccHHHHHHHHHccccccc //