[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55263.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:282 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   17->136 PF00528 * BPD_transp_1 9.6e-06 19.2 120/185  
:PROS 136->147|PS00141|ASP_PROTEASE
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55263.1 GT:GENE BAD55263.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 439704..440552 GB:FROM 439704 GB:TO 440552 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55263.1 LENGTH 282 SQ:AASEQ MNELTTAVRAELARLGRWPVFWIVLGTWVVLNLVFAYLFNYLAYRSGEQSAMADAQPKEVLLQQMLPAAVPEVFTQGMAMFGGALMLILGALAVGSGYGWGTWKTVFTQGPSRVTVAGSALVALALVTVALVVAVFVIDTGTAALIATTESQSLALPDAGRILSGIAYGTAILGMWTLAGAFLGAVARGPALATGLGLVWVLVVENLLRGTAGILGPLRALTDRLPGTAAGSLAGTLRTVDGPATPGVLDILSRGESLVLLAVYALLFAGATVWLMRRRDLA GT:EXON 1|1-282:0| PROS 136->147|PS00141|ASP_PROTEASE|PDOC00128| TM:NTM 6 TM:REGION 20->42| TM:REGION 69->91| TM:REGION 121->143| TM:REGION 163->185| TM:REGION 196->218| TM:REGION 255->276| SEG 77->93|gmamfggalmlilgala| SEG 114->137|vtvagsalvalalvtvalvvavfv| SEG 258->267|lvllavyall| HM:PFM:NREP 1 HM:PFM:REP 17->136|PF00528|9.6e-06|19.2|120/185|BPD_transp_1| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1--1-----1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 49-54| PSIPRED ccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHccccEEEEHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHccccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccc //