[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55264.1
DDBJ      :             putative two-component system sensor kinase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  66/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.122.1
:499 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   191->249,356->420 3gigA PDBj 3e-07 35.6 %
:RPS:PDB   191->245,325->426 3ehjA PDBj 6e-12 22.7 %
:RPS:SCOP  318->429 1id0A  d.122.1.3 * 1e-05 22.5 %
:HMM:SCOP  316->438 1b3qA3 d.122.1.3 * 1.2e-11 25.2 %
:RPS:PFM   191->249 PF07730 * HisKA_3 2e-04 33.9 %
:HMM:PFM   186->249 PF07730 * HisKA_3 1.8e-17 40.6 64/68  
:HMM:PFM   353->438 PF02518 * HATPase_c 7.1e-09 30.2 86/111  
:HMM:PFM   131->198 PF02737 * 3HCDH_N 0.00024 25.4 67/180  
:BLT:SWISS 329->429 DEGS_BREBE 9e-09 27.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55264.1 GT:GENE BAD55264.1 GT:PRODUCT putative two-component system sensor kinase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(440640..442139) GB:FROM 440640 GB:TO 442139 GB:DIRECTION - GB:PRODUCT putative two-component system sensor kinase GB:PROTEIN_ID BAD55264.1 LENGTH 499 SQ:AASEQ MTPPGIANRDSIVRDCAIALIVAMIQVAGGRAANVGQTGVRSLDVLGCVLLLAGPIALVFRQVEPLPVLVLALAACGIYLALDYGYGPVFLAPAVAFLTAAVSGSRWWTYPFVPASFVIFVWPVPALLGRGPGVAVVCAAAGWLVVLVAAAEAVRVRRAMARLREERFDAARRAEAAQRERFACEERLTAARELHDVLAHSLSLINVQSSVALELFERKPMQARSALAAIKKASKDSLDEVHALLPTIRRGPFAGPLADDKTADPDRPRRPGKRGGVSGRLGLPVDRTRHDREPRRDPRRTPAEPAPGPRAPEPGLADLDALVQRARATGLTVQIKVVGDPVELPEAIDTAAAGIVQESLTNVIRHAVGATATVTVRYTAESVDITVDNGRPAGPQTRSPGAGNGIIGMRERAHALGGALTAGPRPSGGYRVAARLPVRVAPTPPTAAGNGGGAPDPSGADRPVERVASSPEPEAPGGNGHPLETDNSPLPAEARAPES GT:EXON 1|1-499:0| BL:SWS:NREP 1 BL:SWS:REP 329->429|DEGS_BREBE|9e-09|27.7|101/386| TM:NTM 6 TM:REGION 7->29| TM:REGION 40->61| TM:REGION 67->84| TM:REGION 86->105| TM:REGION 107->129| TM:REGION 132->154| SEG 65->75|plpvlvlalaa| SEG 130->187|rgpgvavvcaaagwlvvlvaaaeavrvrramarlreerfdaarraeaaqrerfaceer| SEG 265->280|pdrprrpgkrggvsgr| SEG 287->315|rtrhdreprrdprrtpaepapgprapepg| SEG 431->461|rvaarlpvrvaptpptaagngggapdpsgad| BL:PDB:NREP 1 BL:PDB:REP 191->249,356->420|3gigA|3e-07|35.6|121/212| RP:PDB:NREP 1 RP:PDB:REP 191->245,325->426|3ehjA|6e-12|22.7|151/196| RP:PFM:NREP 1 RP:PFM:REP 191->249|PF07730|2e-04|33.9|59/68|HisKA_3| HM:PFM:NREP 3 HM:PFM:REP 186->249|PF07730|1.8e-17|40.6|64/68|HisKA_3| HM:PFM:REP 353->438|PF02518|7.1e-09|30.2|86/111|HATPase_c| HM:PFM:REP 131->198|PF02737|0.00024|25.4|67/180|3HCDH_N| GO:PFM:NREP 4 GO:PFM GO:0000155|"GO:two-component sensor activity"|PF07730|IPR011712| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF07730|IPR011712| GO:PFM GO:0016021|"GO:integral to membrane"|PF07730|IPR011712| GO:PFM GO:0046983|"GO:protein dimerization activity"|PF07730|IPR011712| RP:SCP:NREP 1 RP:SCP:REP 318->429|1id0A|1e-05|22.5|111/146|d.122.1.3| HM:SCP:REP 316->438|1b3qA3|1.2e-11|25.2|123/185|d.122.1.3|1/1|ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase| OP:NHOMO 212 OP:NHOMOORG 66 OP:PATTERN -------------------------------------------------------------------- ----K-11---1--111-------------------4755-3-C3822244--1-211--1453A33ENB3-1111---1--------------------------------------------------------21211---1---------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------2----------------------------------------1-----------------------3------------------------------------------------------------------------------------11--1-----1------11-------11------322------11---------------------1---------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 170 STR:RPRED 34.1 SQ:SECSTR ##############################################################################################################################################################################################HHHHHHHHHHHHHHHHHHHHHHHHHTTTcHHHHHHHHHHHHHHHHHHHHHHHHHTHHcc#####################################################################HHHHHHHHHHHHTTcEEcccccccccccHHHHHHHHHHHHHHHHHHHHTcccEEEEEEEEcccEEEEEEEcccccccTTccTTcccHHHHHHHHHHHTTcEEEEEccccEE###################################################################### DISOP:02AL 1-2, 441-477, 492-499| PSIPRED cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEEccEEEEEEEcccccccccccccccccHHHHHHHHHHHccEEEEEEcccccEEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccc //