[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55266.1
DDBJ      :             putative osmotically inducible protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  219/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
d.227.1
:146 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->145 1nyeF PDBj 5e-20 43.3 %
:RPS:PDB   2->146 3eerA PDBj 2e-19 22.2 %
:RPS:SCOP  3->142 1nyeA  d.227.1.1 * 7e-22 35.0 %
:HMM:SCOP  2->146 1ukkA_ d.227.1.1 * 1.2e-34 40.6 %
:RPS:PFM   48->141 PF02566 * OsmC 1e-08 37.4 %
:HMM:PFM   44->135 PF02566 * OsmC 1.1e-19 37.1 89/99  
:BLT:SWISS 10->145 OSMC_SHIFL 2e-19 42.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55266.1 GT:GENE BAD55266.1 GT:PRODUCT putative osmotically inducible protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 442758..443198 GB:FROM 442758 GB:TO 443198 GB:DIRECTION + GB:PRODUCT putative osmotically inducible protein GB:PROTEIN_ID BAD55266.1 LENGTH 146 SQ:AASEQ MPTRTARTAWTGGLQDGSGQVELASSGVGKYDVSFPKRSADSADGTTSPEELIAAAHSSCYAMALSAQIANAGGTPESLDVTADVTLGPDPAGGFRITGIQLTVRGRVQGLDADGFQAAAEAAKAGCPVSKALAGVDSISLDAALA GT:EXON 1|1-146:0| BL:SWS:NREP 1 BL:SWS:REP 10->145|OSMC_SHIFL|2e-19|42.0|131/143| SEG 118->125|aaaeaaka| BL:PDB:NREP 1 BL:PDB:REP 10->145|1nyeF|5e-20|43.3|127/158| RP:PDB:NREP 1 RP:PDB:REP 2->146|3eerA|2e-19|22.2|135/138| RP:PFM:NREP 1 RP:PFM:REP 48->141|PF02566|1e-08|37.4|91/99|OsmC| HM:PFM:NREP 1 HM:PFM:REP 44->135|PF02566|1.1e-19|37.1|89/99|OsmC| GO:PFM:NREP 1 GO:PFM GO:0006950|"GO:response to stress"|PF02566|IPR003718| RP:SCP:NREP 1 RP:SCP:REP 3->142|1nyeA|7e-22|35.0|137/143|d.227.1.1| HM:SCP:REP 2->146|1ukkA_|1.2e-34|40.6|138/141|d.227.1.1|1/1|OsmC-like| OP:NHOMO 231 OP:NHOMOORG 222 OP:PATTERN -------------------------------------------------------------------- 111-1-------------------------------11111---121----1111--1----2-1111111-----------1------------------2-1151111----------------------------------11-------------------------------------11111------11111111-111111------111----------------------------------------------------------111----------------------------------------------------------------------------------------------1--1--1-----111----111111----------1-11-11-1-12--1--111-111--11-----11111---11111111-111---1------------------------------1--1--11---------------11--------1----------111111--1-1-----------------1--11---------------------1---------------------------------------1---111---------------------------------1----111111111111-111111111111111111111111---1111111111111111-1111111------------------------------1--------------------------1-1111-111111111111------------------------1111111111-------------------------------------------------------------1- ----21--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 145 STR:RPRED 99.3 SQ:SECSTR #ccccccEEEccTTccEEEEETEEETcccEEEEcccGGTccEEcccccHHHHHHHHHHHHHHHHHHHHHHHTTcccccccEEEEEEEEEcccccEEEEEEEEEEccEEEcccHHHHHHHHHHHHHHcHHHHHHTTTcccEEEETTE DISOP:02AL 36-46| PSIPRED ccEEEEEEEEEccccccEEEEEEccccEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEEEEcccccEEEEEEEEEEEEEEccccHHHHHHHHHHHHHcccEEEEEccccEEEEEEEEc //