[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55267.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  38/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:260 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   135->250 PF09490 * CbtA 2e-14 47.2 %
:HMM:PFM   8->250 PF09490 * CbtA 9.6e-31 32.6 224/226  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55267.1 GT:GENE BAD55267.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(443321..444103) GB:FROM 443321 GB:TO 444103 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55267.1 LENGTH 260 SQ:AASEQ MPLTGSLKTLLLRGLLAGLIAGLLAATVGHFVGEPKVEAAIALEEALAATPEEAPAEAAHSHEGASAHSHGDDEALVSRTGQKFGQFLALGLTGLALGAMFAAAAHHARRWTALSGPALALVLAAGGWAAVVAVPFFKYPANPPAVGDPDTIDHRTLLWFAVVLLGIAAVGAGGFVHRLLAGHPATLRLIAGVLAFVAVTAVGYVALPGVDEVPAGFPPSLLWQFRVSSLAVSATLWTALGLGFAALTERATRSRELVAA GT:EXON 1|1-260:0| TM:NTM 6 TM:REGION 9->31| TM:REGION 85->106| TM:REGION 115->137| TM:REGION 154->176| TM:REGION 187->209| TM:REGION 227->248| SEG 3->27|ltgslktlllrgllagliagllaat| SEG 38->67|eaaialeealaatpeeapaeaahshegasa| SEG 87->134|flalgltglalgamfaaaahharrwtalsgpalalvlaaggwaavvav| SEG 160->176|favvllgiaavgaggfv| RP:PFM:NREP 1 RP:PFM:REP 135->250|PF09490|2e-14|47.2|106/228|CbtA| HM:PFM:NREP 1 HM:PFM:REP 8->250|PF09490|9.6e-31|32.6|224/226|CbtA| OP:NHOMO 46 OP:NHOMOORG 38 OP:PATTERN -------------------------------------------------------------------- ----1---------------------------1---1111--1---------1--------------1-11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------1---------------------------1----1-111-----------------22222222------------------------------------------------1111111------11------1-1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHccEEEEEEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //