[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55268.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:65 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   10->65 PF09489 * CbtB 1.4e-07 38.0 50/55  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55268.1 GT:GENE BAD55268.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(444094..444291) GB:FROM 444094 GB:TO 444291 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55268.1 LENGTH 65 SQ:AASEQ MAIAHSPTTRSTDSVATVLVTIGVVLLALLTLYLVGFDQGAVSRGGMFLHELMHDGRHLLGVPCH GT:EXON 1|1-65:0| TM:NTM 1 TM:REGION 22->44| SEG 15->36|vatvlvtigvvllalltlylvg| HM:PFM:NREP 1 HM:PFM:REP 10->65|PF09489|1.4e-07|38.0|50/55|CbtB| OP:NHOMO 6 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1112------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-12| PSIPRED ccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccEEEccccc //