[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55269.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  59/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.58.4
:107 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->98 1iujB PDBj 1e-13 43.2 %
:RPS:PDB   3->97 2bbeA PDBj 4e-14 12.8 %
:RPS:SCOP  3->99 1iujA  d.58.4.5 * 2e-15 36.1 %
:HMM:SCOP  1->101 1sqeA_ d.58.4.5 * 2.8e-25 43.0 %
:RPS:PFM   11->76 PF03992 * ABM 2e-04 39.4 %
:HMM:PFM   3->76 PF03992 * ABM 2.4e-21 33.8 74/78  
:BLT:SWISS 6->75 YHGC_BACSU 4e-10 40.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55269.1 GT:GENE BAD55269.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(444475..444798) GB:FROM 444475 GB:TO 444798 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55269.1 LENGTH 107 SQ:AASEQ MAVVKINAIEVPEGAGPELEKRFAHRAHAVENSPGFLGFQLLRPVAGDNRYFVVTQWDSEESFAAWRDGPARAAHAGSGEQKPVATGASLLEFEVVLDVPAKAGAGE GT:EXON 1|1-107:0| BL:SWS:NREP 1 BL:SWS:REP 6->75|YHGC_BACSU|4e-10|40.6|69/166| BL:PDB:NREP 1 BL:PDB:REP 4->98|1iujB|1e-13|43.2|95/103| RP:PDB:NREP 1 RP:PDB:REP 3->97|2bbeA|4e-14|12.8|94/103| RP:PFM:NREP 1 RP:PFM:REP 11->76|PF03992|2e-04|39.4|66/78|ABM| HM:PFM:NREP 1 HM:PFM:REP 3->76|PF03992|2.4e-21|33.8|74/78|ABM| GO:PFM:NREP 3 GO:PFM GO:0005737|"GO:cytoplasm"|PF03992|IPR007138| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF03992|IPR007138| GO:PFM GO:0017000|"GO:antibiotic biosynthetic process"|PF03992|IPR007138| RP:SCP:NREP 1 RP:SCP:REP 3->99|1iujA|2e-15|36.1|97/102|d.58.4.5| HM:SCP:REP 1->101|1sqeA_|2.8e-25|43.0|100/0|d.58.4.5|1/1|Dimeric alpha+beta barrel| OP:NHOMO 64 OP:NHOMOORG 60 OP:PATTERN -------------------------------------------------------------------- ------11222---11111-1-111111111-11111111-2111-111------11---11--1111-11-----------------------------------------------------------------1--1----------------------------------------------11-----1------1---11-11------------1---------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 97 STR:RPRED 90.7 SQ:SECSTR #cEEEEEEEEEcTTcHHHHHHHHHTTHHHHHTcTTEEEEEEEEccccTTEEEEEEEEccHHHHHHHHTcHHHHHHHHHTTHHHHEEEEEEEEEccEEc######### DISOP:02AL 69-86, 101-107| PSIPRED ccEEEEEEEEcccccHHHHHHHHHHHHHHHHccccEEEEEEEEcccccccEEEEEEEccHHHHHHHHccHHHHHHccccccccccccccEEEEEEEEcccccccccc //