[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55273.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  38/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:196 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   70->109 PF01345 * DUF11 0.00018 28.2 39/76  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55273.1 GT:GENE BAD55273.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 447453..448043 GB:FROM 447453 GB:TO 448043 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55273.1 LENGTH 196 SQ:AASEQ MVLALVIWLVLMVARGGDSPGDAAAATTTSTSSADRATETTKPSGSADPSAPKSSGASTTAAAPVANQCPDQSLAVKVTVAQPTYRVGEQPVFGIVITNISAEPCARDVGSAAQQVFVQTLDGTRRLWASTDCYPDGQPDVRTLDRGEQAAFQVTWSGSTSQPNCAGERVPVPPGAYSVVAQLGSVRSAAEPFNIA GT:EXON 1|1-196:0| SEG 14->41|arggdspgdaaaatttstssadratett| HM:PFM:NREP 1 HM:PFM:REP 70->109|PF01345|0.00018|28.2|39/76|DUF11| OP:NHOMO 38 OP:NHOMOORG 38 OP:PATTERN -------------------------------------------------------------------- -----111111-1111111-11111111111111111111----1------1----1-------1-1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 23-69, 163-167| PSIPRED cHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEccccccccccEEEEEEEEEcccccEEEEccccEEEEEEEEccccccEEEcccccccccccEEEEEccccEEEEEEEcccccccccccccccccccEEEEEEEEcccccccEEEEEc //