[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55276.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:88 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   29->47 PF00008 * EGF 0.0006 42.1 19/32  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55276.1 GT:GENE BAD55276.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(450276..450542) GB:FROM 450276 GB:TO 450542 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55276.1 LENGTH 88 SQ:AASEQ MRLDNGAINCAGQGHNEGTAGVDRTAGVCITLCQNELSTGITCGCPERMSWRSRGKPPRDPSTVMQRMPTRPCRRPRNQRARVDYYAA GT:EXON 1|1-88:0| SEG 69->82|ptrpcrrprnqrar| HM:PFM:NREP 1 HM:PFM:REP 29->47|PF00008|0.0006|42.1|19/32|EGF| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 50-64, 71-73, 75-77, 82-83| PSIPRED cccccccEEccccccccccccccccccHHHHHHHHHHcccEEccccccccHHHcccccccHHHHHHHcccccccccccccccEEEEcc //