[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55282.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:92 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   22->85 PF04290 * DctQ 3.9e-05 29.0 62/133  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55282.1 GT:GENE BAD55282.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 454854..455132 GB:FROM 454854 GB:TO 455132 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55282.1 LENGTH 92 SQ:AASEQ MVIPNQPIGTPIEHPHATAVLFLGAASILCCGVLGPVAWALGKRALDQIEASGGAIGGRVQVMVGYILGVVGTVLMIIMAVLFLLVVLGGNA GT:EXON 1|1-92:0| TM:NTM 2 TM:REGION 17->39| TM:REGION 63->85| HM:PFM:NREP 1 HM:PFM:REP 22->85|PF04290|3.9e-05|29.0|62/133|DctQ| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1----------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED cccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //