[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55286.1
DDBJ      :             putative ABC transporter ATP-binding protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  126/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:278 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   3->44 2awoD PDBj 2e-04 38.1 %
:BLT:PDB   20->229 3d31A PDBj 8e-12 23.6 %
:RPS:PDB   2->226 3dmdC PDBj 2e-19 7.8 %
:RPS:SCOP  4->214 1sgwA  c.37.1.12 * 3e-19 14.8 %
:HMM:SCOP  6->216 1ii8.1 c.37.1.12 * 6.5e-50 33.5 %
:HMM:PFM   43->165 PF00005 * ABC_tran 9.3e-18 32.7 110/118  
:HMM:PFM   30->49 PF02463 * SMC_N 3.2e-05 50.0 20/220  
:BLT:SWISS 4->224 ZNUC_SHISS 3e-17 28.1 %
:PROS 138->152|PS00211|ABC_TRANSPORTER_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55286.1 GT:GENE BAD55286.1 GT:PRODUCT putative ABC transporter ATP-binding protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(458128..458964) GB:FROM 458128 GB:TO 458964 GB:DIRECTION - GB:PRODUCT putative ABC transporter ATP-binding protein GB:PROTEIN_ID BAD55286.1 LENGTH 278 SQ:AASEQ MPAVRLRAARLSFGERTLWDGLDLDIRPGEFVAVLGPNGSGKTSLLKVLLGQLQLTEGTAEVVGKPARAGNADIGYIPQQRTIDAGVQLRGVDLVGLGVDGHRWGLGLRGRAERNRKVAAAVAAVGAQHYADAPLETMSGGEQQRLRVAQALVGDPEVLLCDEPLLSLDLANQRLVAELIDKRRRSHDTAVLFVTHEINPILPLVDRVLYLVDGRFRIGTPAEVMTSEVLSELYRTEVDVLRVRGRLVVVGTGDTLDALGSAGAEHCHAEPSHSGVNA GT:EXON 1|1-278:0| BL:SWS:NREP 1 BL:SWS:REP 4->224|ZNUC_SHISS|3e-17|28.1|203/251| PROS 138->152|PS00211|ABC_TRANSPORTER_1|PDOC00185| SEG 45->55|llkvllgqlql| SEG 86->101|gvqlrgvdlvglgvdg| SEG 111->133|raernrkvaaavaavgaqhyada| SEG 159->170|llcdepllsldl| SEG 238->256|vdvlrvrgrlvvvgtgdtl| BL:PDB:NREP 2 BL:PDB:REP 3->44|2awoD|2e-04|38.1|42/299| BL:PDB:REP 20->229|3d31A|8e-12|23.6|203/348| RP:PDB:NREP 1 RP:PDB:REP 2->226|3dmdC|2e-19|7.8|206/318| HM:PFM:NREP 2 HM:PFM:REP 43->165|PF00005|9.3e-18|32.7|110/118|ABC_tran| HM:PFM:REP 30->49|PF02463|3.2e-05|50.0|20/220|SMC_N| RP:SCP:NREP 1 RP:SCP:REP 4->214|1sgwA|3e-19|14.8|196/200|c.37.1.12| HM:SCP:REP 6->216|1ii8.1|6.5e-50|33.5|206/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 132 OP:NHOMOORG 129 OP:PATTERN -----------------------------1-------------1-----------1------------ ----11-----111112----11111-----1111111111-1-1----1111111-1--11111111---1111111-----------------------------1---------------------------------------------11------------------------------------1-----------1---1--1--1-------11------------------------------------------------------------------------------------------1--------------------------------------------------------------1-------------------------------1------------------2-111--1-----1--------11111111111---1---------------------------------1---111-111111111111121111111111------11--11------------------------1-------1---1-----------------11-1-----------------------------11-------------------------------------------------------------------------------------------------------------------------------------------1-1------------------------------------------------------------------------1-1-1-1-------------------------------------------------------------1-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 272-278| PSIPRED ccEEEEEEEEEEEccEEEEEcccEEEcccEEEEEEccccccHHHHHHHHHccccccccEEEEccccccHHHcccccccccccccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHcccHHHHcccHHHcccHHHHHHHHHHHHHccccEEEEEccHHHccHHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHcEEEEEcccEEEEcccHHHHccHHHHHHHcccEEEEEEccEEEEEcccccccccccccccccccccccccccc //