[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55287.1
DDBJ      :             putative periplasmic solute-binding proteins
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  123/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.92.2
:330 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   37->96 3hh8A PDBj 3e-07 37.3 %
:RPS:PDB   37->326 3cx3A PDBj 2e-23 18.2 %
:RPS:SCOP  34->330 1xvlA1  c.92.2.2 * 9e-34 20.4 %
:HMM:SCOP  37->330 1pq4A_ c.92.2.2 * 3.2e-61 34.2 %
:RPS:PFM   30->329 PF01297 * SBP_bac_9 3e-16 29.2 %
:HMM:PFM   18->329 PF01297 * SBP_bac_9 7.9e-66 32.4 290/303  
:BLT:SWISS 36->106 MNTA_LISIN 5e-07 37.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55287.1 GT:GENE BAD55287.1 GT:PRODUCT putative periplasmic solute-binding proteins GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(459090..460082) GB:FROM 459090 GB:TO 460082 GB:DIRECTION - GB:PRODUCT putative periplasmic solute-binding proteins GB:PROTEIN_ID BAD55287.1 LENGTH 330 SQ:AASEQ MWSPVVRNRITRFAGIALGAVTIAAATACSGGSDGGDRITVVASTNVWGDIAAAVAGPDAEVSSLISDPAADPHSYEVTAVQAAELSDADLIVYNGGHYDEFIDKAIGGKNKRTVNAVEIAGGGADEHGHDHGAEGDAQAAPADGHDHGNHEHDAHEHDNEHVWYDTHVAGEVAERIADSLGELDPDHRQAYADRAAAFTARLAGIDAVVDRIAAEHPNQPVVQTEPLAQYLVLAAKADDRTPHEFQEAIEQGTDPSPAAVAAVRDLITTKQVRALIYNVQTEDKITKDIRALADTAGIAVVEVTETLPEGLDYIQWQTRNAEALATALA GT:EXON 1|1-330:0| BL:SWS:NREP 1 BL:SWS:REP 36->106|MNTA_LISIN|5e-07|37.1|70/310| SEG 14->28|agialgavtiaaata| SEG 119->141|eiagggadehghdhgaegdaqaa| SEG 143->162|adghdhgnhehdahehdneh| SEG 189->204|rqayadraaaftarla| BL:PDB:NREP 1 BL:PDB:REP 37->96|3hh8A|3e-07|37.3|59/280| RP:PDB:NREP 1 RP:PDB:REP 37->326|3cx3A|2e-23|18.2|253/259| RP:PFM:NREP 1 RP:PFM:REP 30->329|PF01297|3e-16|29.2|271/291|SBP_bac_9| HM:PFM:NREP 1 HM:PFM:REP 18->329|PF01297|7.9e-66|32.4|290/303|SBP_bac_9| GO:PFM:NREP 2 GO:PFM GO:0030001|"GO:metal ion transport"|PF01297|IPR006127| GO:PFM GO:0046872|"GO:metal ion binding"|PF01297|IPR006127| RP:SCP:NREP 1 RP:SCP:REP 34->330|1xvlA1|9e-34|20.4|265/279|c.92.2.2| HM:SCP:REP 37->330|1pq4A_|3.2e-61|34.2|281/289|c.92.2.2|1/1|"Helical backbone" metal receptor| OP:NHOMO 144 OP:NHOMOORG 124 OP:PATTERN -------------------------------------------1------------------------ ----11-111111-11211-1111111111111-1-11111-1-1----1111111-1-----1111-1--2333222-----------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------1112211222221111111121-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111---------------------------------------------111111111111121111111111---------------------------------------------------------------------------------------------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 265 STR:RPRED 80.3 SQ:SECSTR ###################################ccccEEEEccHHHHHHHHHHHTTccEEEEcEccccccTTTccccHHHHHHHHHccEEEEccTTTccTTTTccTTTTTcccEEEETTTTccccccccccccc##########################GGGcHHHHHHHHHHHHHHHHHHcGGGHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEcccHHHHHHTTccEEEEEEccEcccTTcccccHHHHHHHHHHHHTTcccEEEccccccHHcTTHHHHHccccEEEccccccccccccHHHHHHHHHHHHH#### DISOP:02AL 1-7, 28-38, 249-258| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEEHHHHHHHHHHccccEEEEEEEcccccccccccccHHHHHHHHHccEEEEEccccHHHHHHHHHHccccccEEEEccccccccccccccccccccccccccccccccccccccccccEEEEcHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEccHHHHHHHHcccEEccHHHHHccccccccccHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHHcccEEEEccccccccccHHHHHHHHHHHHHHHHc //