[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55293.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  55/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.40.4d.38.1
:310 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   32->310 2bi0A PDBj 5e-16 12.2 %
:RPS:SCOP  25->197 2bi0A1  d.38.1.4 * 4e-14 10.9 %
:RPS:SCOP  185->303 2gnrA1  b.40.4.15 * 1e-15 18.1 %
:HMM:SCOP  18->198 2bi0A1 d.38.1.4 * 5e-21 28.0 %
:RPS:PFM   27->67 PF01575 * MaoC_dehydratas 2e-04 48.8 %
:RPS:PFM   236->294 PF01796 * DUF35 5e-12 57.6 %
:HMM:PFM   233->295 PF01796 * DUF35 3.9e-20 55.6 63/68  
:HMM:PFM   31->67 PF01575 * MaoC_dehydratas 1.2e-05 37.8 37/123  
:HMM:PFM   196->220 PF12172 * DUF35_N 0.00046 36.0 25/37  
:BLT:SWISS 25->133 Y4636_STRCO 1e-10 37.0 %
:BLT:SWISS 226->300 Y1552_METJA 4e-12 38.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55293.1 GT:GENE BAD55293.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 468289..469221 GB:FROM 468289 GB:TO 469221 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55293.1 LENGTH 310 SQ:AASEQ MPDTTTPEAIVAAAEQIIAAGECAPRLARDPVNQPMINNWVEAIGDTNPIYVDEAAARAAGHPGIVAPPAMAQVWTMFGLGGVRPPDDPMAQTNDLLDAAGYTSVVGTNCEQIYHRYLVPGEQVTVTSRLDSISGPKRTGLGEGWFVTFRTLWYVGDELVTEMLFRILKFAPRPAAEQPAGERVKPLVSHDTEFFWAGTKLGELRIQRLPDGTLRHPPIPAVWKDKSEQTDYVVASGRGTVFSYVVHHAPKVPGRQLPFVVALVELEEGVRMLGELRGIDPGEVRVGLPVEVAFEQLDDDATLPYWKVTA GT:EXON 1|1-310:0| BL:SWS:NREP 2 BL:SWS:REP 25->133|Y4636_STRCO|1e-10|37.0|100/150| BL:SWS:REP 226->300|Y1552_METJA|4e-12|38.7|75/141| SEG 8->24|eaivaaaeqiiaageca| RP:PDB:NREP 1 RP:PDB:REP 32->310|2bi0A|5e-16|12.2|262/327| RP:PFM:NREP 2 RP:PFM:REP 27->67|PF01575|2e-04|48.8|41/116|MaoC_dehydratas| RP:PFM:REP 236->294|PF01796|5e-12|57.6|59/66|DUF35| HM:PFM:NREP 3 HM:PFM:REP 233->295|PF01796|3.9e-20|55.6|63/68|DUF35| HM:PFM:REP 31->67|PF01575|1.2e-05|37.8|37/123|MaoC_dehydratas| HM:PFM:REP 196->220|PF12172|0.00046|36.0|25/37|DUF35_N| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF01575|IPR002539| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF01575|IPR002539| RP:SCP:NREP 2 RP:SCP:REP 25->197|2bi0A1|4e-14|10.9|156/178|d.38.1.4| RP:SCP:REP 185->303|2gnrA1|1e-15|18.1|116/137|b.40.4.15| HM:SCP:REP 18->198|2bi0A1|5e-21|28.0|161/0|d.38.1.4|1/1|Thioesterase/thiol ester dehydrase-isomerase| OP:NHOMO 118 OP:NHOMOORG 59 OP:PATTERN -----------------------------------11-1------------------------1---- ----2---------17511-12--4211111322521434-7-4----------------112----2-2------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2----------111---12111----------------------3--------------------------------------------------------------------------1-53--21-------------------------3--1-------------1--1-----------------------2-1----------------------------------------------------------------1--------1------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 285 STR:RPRED 91.9 SQ:SECSTR ########################EEccEEEccHHHHHHHHHHHccccHHHHcHHHHHHHHcccccccHHHHHHHHHHHHTcEEcccccHHHcccHHTTTTTccEEEEEEcEEccccccTTcEEEEEEEEEEEEccccTTcccEEEEEEEEEEcTTccEEEEEEEEEEEccTTcccccccccccTccccccTTTTccHHHHHHHcccccccGGGTTcEEEcccEEcccHHHHHHHTTcccGG#GTcTTTTccccccHHHHHHHHHcTTccEEEEEEEEEEcccccTTcEEEEEEEEEEEEEccccEEEEE DISOP:02AL 1-6, 172-184| PSIPRED ccccccccHHHHHHHccccccccccccccccccHHHHHHHHHHHHcccccEEcHHHHHHcccccccccHHHHHHHHHHHccccccccccHHHHHHHcccccccEEEEccEEEEEEEcEEcccEEEEEEEEEEEEcccccEEcccEEEEEEEEEEEcccEEEEEEEEEEEEccccccccccccccccccccccHHHHHHHHccEEEEEEcccccEEEccHHHccccccccEEEEEEcccEEEEEEEEEEccccccccccEEEEEEEEccccEEEEEEEcccHHHEEcccEEEEEEEEccccccccEEEEEc //