[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55303.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:152 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   8->60 PF02669 * KdpC 0.00051 28.3 53/188  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55303.1 GT:GENE BAD55303.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 476778..477236 GB:FROM 476778 GB:TO 477236 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55303.1 LENGTH 152 SQ:AASEQ MTRFLAALAGALLVAAVALIFAPAALPALVLVVLSWWFRSAAVGAVLLTVAVLALAADIGVVEAAATGLVATAYLLNAATVAAPAGVVPTTLPSVLGAVGGTACAATAAVLPLHLAWLPALAPVAVIALYAVLVPTLTPRPTPAAAPSPRRE GT:EXON 1|1-152:0| TM:NTM 4 TM:REGION 8->30| TM:REGION 41->63| TM:REGION 74->96| TM:REGION 112->134| SEG 5->34|laalagallvaavalifapaalpalvlvvl| SEG 41->57|aavgavlltvavlalaa| SEG 69->93|lvatayllnaatvaapagvvpttlp| SEG 95->151|vlgavggtacaataavlplhlawlpalapvavialyavlvptltprptpaaapsprr| HM:PFM:NREP 1 HM:PFM:REP 8->60|PF02669|0.00051|28.3|53/188|KdpC| OP:NHOMO OP:NHOMOORG 0 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 143-152| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccc //