[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55304.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  72/915 : Eukaryota  165/199 : Viruses  0/175   --->[See Alignment]
d.38.1
:286 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->274 1s9cC PDBj 2e-34 30.5 %
:RPS:PDB   15->286 2bi0A PDBj 9e-13 10.9 %
:RPS:SCOP  17->144 1pn2A1  d.38.1.4 * 2e-32 23.6 %
:RPS:SCOP  160->285 2c2iA1  d.38.1.4 * 6e-11 13.5 %
:HMM:SCOP  8->162 1s9cA2 d.38.1.4 * 6.4e-43 39.0 %
:HMM:SCOP  160->286 1s9cA1 d.38.1.4 * 3.5e-27 31.7 %
:HMM:PFM   164->260 PF01575 * MaoC_dehydratas 1.1e-29 30.9 97/123  
:BLT:SWISS 8->274 DHB4_HUMAN 1e-32 31.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55304.1 GT:GENE BAD55304.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(477323..478183) GB:FROM 477323 GB:TO 478183 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55304.1 LENGTH 286 SQ:AASEQ MPIDPSVALGAQLPSREFAWTPSDVQLYHLGLGAGTRWTDEAELRYLDDREPQVLPTFATVAQTLHETEPPKVSFPGIDIDLAKVVHAHQEVQVHRPIPAAGKATSTGRISELWDKGSAAVIVQEHTITGSDGAPLWTTRSSIFAKGEGGFGGERGPSTRTELPDRDPDAEVAIPTLPQQALLYRMLGDRNPLHSDPAFAKAAGFPAPILHGLCTYGLVCKAATDTVLDSDATRVTGFRARFAGVLFPGETIRARIWRGAGELTIAATVADRDDAPVLGDVTLTFQ GT:EXON 1|1-286:0| BL:SWS:NREP 1 BL:SWS:REP 8->274|DHB4_HUMAN|1e-32|31.7|265/736| SEG 147->156|geggfggerg| SEG 197->208|pafakaagfpap| BL:PDB:NREP 1 BL:PDB:REP 8->274|1s9cC|2e-34|30.5|256/271| RP:PDB:NREP 1 RP:PDB:REP 15->286|2bi0A|9e-13|10.9|258/327| HM:PFM:NREP 1 HM:PFM:REP 164->260|PF01575|1.1e-29|30.9|97/123|MaoC_dehydratas| RP:SCP:NREP 2 RP:SCP:REP 17->144|1pn2A1|2e-32|23.6|123/148|d.38.1.4| RP:SCP:REP 160->285|2c2iA1|6e-11|13.5|126/149|d.38.1.4| HM:SCP:REP 8->162|1s9cA2|6.4e-43|39.0|154/0|d.38.1.4|1/1|Thioesterase/thiol ester dehydrase-isomerase| HM:SCP:REP 160->286|1s9cA1|3.5e-27|31.7|126/0|d.38.1.4|1/1|Thioesterase/thiol ester dehydrase-isomerase| OP:NHOMO 383 OP:NHOMOORG 237 OP:PATTERN -------------------------------------------------------------------- ----1---------12222-22--2122222232222344--------------------111----111----------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------1--2-------211---21211----------------------2-1------1---------------------------1-----1---------------------------------1---4212----1----------------1----12--------111-1----------------------1---1-1-------------------------1-----------------------------------------------1------11-1----------------------------------------------------------------------------------------------------------------------------------------------1111-------------------------------------------------------------------------------------------------------------- ----111-----11222223222122133333322222222223332222224334222222111111111111111111111111---22222221111232332-1--2111113111-111121113E1-1141-1-2111-1111111-1-2111121111111112-111-1-------11141211--1111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 279 STR:RPRED 97.6 SQ:SECSTR #######GcccccccccEEccHHHHHHHHHHHcccTTcGcccHHHHTTcHHHHHHHHcccccccHHHHHHHHHHHHTTTTTTccEEEEEEcEEccccccTTcEEEEEEEEEEEEEccccTEEEEEEEEEcTTccEEEEEEEEEEEccTTcccccccccccccGGGTTcEEEcccEEcccHHHHHHHTTcccGGGTcHHHHHTTTTccccccHHHHHHHHHHHHTHHHcTTccEEEEEEEEEEcccccTTcEEEEEEEcccEEEEEEEEEEEccccTTcccEEEEEE DISOP:02AL 147-166| PSIPRED ccccHHHHcccccccEEEEEccHHHEEHHHHcccccccccccEEEEEccccccccccHHHHHHHHHHccccEEEcccccccHHHHEEEEEEEEEEEEcccccEEEEEEEEEEEEEccccEEEEEEEEEEcccccEEEEEEEEEEEEcccccccccccccccccccccccEEEEEEcHHHHHHHHHHHcccccccccHHHHHHcccccEEEHHHHHHHHHHHHHHHHHcccccEEEEEEEEEEccccccccEEEEEEEEcccEEEEEEEEEEcccEEEEEcEEEEEc //