[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55307.1
DDBJ      :             putative hydratase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  226/915 : Eukaryota  8/199 : Viruses  0/175   --->[See Alignment]
d.177.1
:261 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->260 2eb5A PDBj 1e-50 40.3 %
:RPS:PDB   1->260 2eb4A PDBj 9e-55 39.2 %
:RPS:SCOP  2->261 1sv6A  d.177.1.1 * 4e-60 39.2 %
:HMM:SCOP  2->260 1sv6A_ d.177.1.1 * 9e-78 40.2 %
:RPS:PFM   106->257 PF01557 * FAA_hydrolase 4e-09 30.3 %
:HMM:PFM   56->260 PF01557 * FAA_hydrolase 1.2e-22 23.5 196/217  
:BLT:SWISS 7->260 MHPD_BURXL 1e-53 42.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55307.1 GT:GENE BAD55307.1 GT:PRODUCT putative hydratase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 481856..482641 GB:FROM 481856 GB:TO 482641 GB:DIRECTION + GB:PRODUCT putative hydratase GB:PROTEIN_ID BAD55307.1 LENGTH 261 SQ:AASEQ MLSDAVRTELADELWRAETERVAIDPLVARHPDIDVVDAYEIQLINIRRRLDTGARVVGHKVGLSSLAMQQMMGVDEPDYGHLLAEMEVFEDVPVEAGRYLFPRVEVEVGFVLGADLPGADCTEADVLAATVAYAPAIELIDSRIKDWNIGLCDTISDNASSAGFVLGPQRVAPADIDIKAIDAVLTRNGEVVAEGRSDAVLGDPVIAVAWLARKVASFGVRLRKGDIVLPGSCTRAIDARPGDTFHAEFAGLGSVRLQFT GT:EXON 1|1-261:0| BL:SWS:NREP 1 BL:SWS:REP 7->260|MHPD_BURXL|1e-53|42.5|254/269| SEG 175->184|adidikaida| BL:PDB:NREP 1 BL:PDB:REP 1->260|2eb5A|1e-50|40.3|258/259| RP:PDB:NREP 1 RP:PDB:REP 1->260|2eb4A|9e-55|39.2|260/261| RP:PFM:NREP 1 RP:PFM:REP 106->257|PF01557|4e-09|30.3|145/213|FAA_hydrolase| HM:PFM:NREP 1 HM:PFM:REP 56->260|PF01557|1.2e-22|23.5|196/217|FAA_hydrolase| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF01557|IPR002529| GO:PFM GO:0008152|"GO:metabolic process"|PF01557|IPR002529| RP:SCP:NREP 1 RP:SCP:REP 2->261|1sv6A|4e-60|39.2|260/261|d.177.1.1| HM:SCP:REP 2->260|1sv6A_|9e-78|40.2|259/261|d.177.1.1|1/1|FAH| OP:NHOMO 425 OP:NHOMOORG 234 OP:PATTERN -------------------------------------------------------------------- 1--1-1--------23111-11--111111113242559A-1-3--------21111---324-----2----------------------------------1--------------------------------22212----2-------------------------------------111-2---2--------2--2-------11---2---2-1--------2-1--------------1111--------1-----22-----11-------------------------------------------------------------------------------------1---21--------------------4433---1-11-1111111111----1--3--2-2-2---1-21-2---1----1------11---------1---1---------------------------------4B--321--122421-111-11331111-18461844--3322713-314-23--------------------58----------------------------1---------------------------------------1--------1------1---2----1---------------111-1---12-12-21-12111-222-221222--22-111111111111111111--1112---11111111111---1-------------1--------------1----------6-111111-2--123---------------------------1------------------------------------------------------------------------- -------------------1---212--------------------------1---------------------------------------------------------------------------------------------------------1----1------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 261 STR:RPRED 100.0 SQ:SECSTR cccHHHHHHHHHHHHHHHHHTcccccHHHHcTTccHHHHHHHHHHHHHHHHHTTccEEEEEEEcHHHHHcccccccccEEEEEEGGGEEcTTEEEcGGGccccEEEEEEEEEEccccccccccHHHHHHHEEEEEEEEEEEcccccccccHHHHHHHTGGGEEEEEEccccccTTcccGGGcEEEEEETTEEEEEEEGGGTTTcTTHHHHHHHHHHGGGTccccTTcEEEcccccccEEccTTcEEEEEcGGGcEEEEEEE DISOP:02AL 1-2| PSIPRED cccHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHccccEEEEEEccccHHHHHHccccccEEEEEEcccccccccEEEcccccccEEcEEEEEEEccccccccccHHHHHHHHHHHHHHHHHcccccccccccccEEEccccccccEEEccccccHHHccHHHcEEEEEEccEEEEEcccHHHHccHHHHHHHHHHHHHHcccccccccEEEEccccccEEcccccEEEEEEEccEEEEEEEc //