[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55309.1
DDBJ      :             putative 4-hydroxy-2-oxovalerate aldolase
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  142/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.5.7c.1.10
:345 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->336 1nvmG PDBj 2e-86 47.2 %
:RPS:PDB   9->332 3bg9A PDBj 3e-34 13.9 %
:RPS:SCOP  9->290 1nvmA2  c.1.10.5 * 2e-73 46.1 %
:RPS:SCOP  291->341 1nvmA1  a.5.7.1 * 2e-17 47.1 %
:HMM:SCOP  8->291 1rqbA2 c.1.10.5 * 2.7e-59 31.3 %
:HMM:SCOP  291->341 1nvmA1 a.5.7.1 * 2.8e-18 66.7 %
:RPS:PFM   129->243 PF00682 * HMGL-like 2e-13 36.0 %
:RPS:PFM   278->338 PF07836 * DmpG_comm 4e-19 68.9 %
:HMM:PFM   17->247 PF00682 * HMGL-like 2.1e-42 29.6 213/237  
:HMM:PFM   275->339 PF07836 * DmpG_comm 2.7e-33 69.2 65/66  
:BLT:SWISS 13->345 NAHM_PSEPU 4e-92 48.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55309.1 GT:GENE BAD55309.1 GT:PRODUCT putative 4-hydroxy-2-oxovalerate aldolase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 483574..484611 GB:FROM 483574 GB:TO 484611 GB:DIRECTION + GB:PRODUCT putative 4-hydroxy-2-oxovalerate aldolase GB:PROTEIN_ID BAD55309.1 LENGTH 345 SQ:AASEQ MAYSAELDIRVTDTSLRDGSHHKRHQFTATEVRDIVAALDGAGVPVIEVTHGDGLGGSSFNYGFSKTPEQELVTIAAQTAKQAKIAVLMLPGVGVKEDIKVSQDNGASICRIATHCTEADVSIQHFGLARELGLETVGFLMMSHTQPPEVLAKQARIMADAGCQCVYIVDSAGALVLEQVSDRVAAVVAELGDDAQVGFHGHENLDLAVANSIYAIRAGATQIDGSARRFGAGAGNTPVEALVGVCDKLGIRTGIDFFAIADAAEDVVRPAMPQECLLDRQALMMGYAGVYSSFLKHAERQAERYGVSAAEMLVRAGRRKLVGGQEDQLIDIALELQREQQTATV GT:EXON 1|1-345:0| BL:SWS:NREP 1 BL:SWS:REP 13->345|NAHM_PSEPU|4e-92|48.6|333/346| SEG 73->87|vtiaaqtakqakiav| SEG 255->264|idffaiadaa| BL:PDB:NREP 1 BL:PDB:REP 11->336|1nvmG|2e-86|47.2|326/339| RP:PDB:NREP 1 RP:PDB:REP 9->332|3bg9A|3e-34|13.9|316/601| RP:PFM:NREP 2 RP:PFM:REP 129->243|PF00682|2e-13|36.0|114/237|HMGL-like| RP:PFM:REP 278->338|PF07836|4e-19|68.9|61/66|DmpG_comm| HM:PFM:NREP 2 HM:PFM:REP 17->247|PF00682|2.1e-42|29.6|213/237|HMGL-like| HM:PFM:REP 275->339|PF07836|2.7e-33|69.2|65/66|DmpG_comm| GO:PFM:NREP 3 GO:PFM GO:0003824|"GO:catalytic activity"|PF00682|IPR000891| GO:PFM GO:0016833|"GO:oxo-acid-lyase activity"|PF07836|IPR012425| GO:PFM GO:0019439|"GO:aromatic compound catabolic process"|PF07836|IPR012425| RP:SCP:NREP 2 RP:SCP:REP 9->290|1nvmA2|2e-73|46.1|282/289|c.1.10.5| RP:SCP:REP 291->341|1nvmA1|2e-17|47.1|51/51|a.5.7.1| HM:SCP:REP 8->291|1rqbA2|2.7e-59|31.3|281/303|c.1.10.5|1/1|Aldolase| HM:SCP:REP 291->341|1nvmA1|2.8e-18|66.7|51/51|a.5.7.1|1/1|post-HMGL domain-like| OP:NHOMO 211 OP:NHOMOORG 145 OP:PATTERN ---------------------------------------------1---------------------1 --2-----------21122-21--2222222232223278---3----------------212-1---21-------------------------------------11---------------------------11111--1-1-----------------------------------------1---1--------1--1------------1---1----------1---------------------------------------------1----------------------------------------------------------------------1---11---1--1---11--------------------1------1----------------------------1------------1------------------------------------------------------------23--1-------2--1------121111-14241132--11112-1--111-1--------------------35---------1----------------------11-1--------------------------------1--------1------1---1----1---------------111-1---11-11-11-11111-111111-1111--1-----------------1------1---------------------------11--1-------------------------4-----1------22--11----------------------------------------1---1111----------------------------------------------1-- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 341 STR:RPRED 98.8 SQ:SECSTR cEETcccTcEEEEcTTTHHHHHcTTcccHHHHHHTHHHHHHHcTTccEEEEEEcccHHHHHHHTccccHHHHHHHHHHHcccccEEEETTTcTcHHHHHHHHHHHTccEEEEEcccccHHHHHHHHHHHHHHTccccTTcccccTTcHHHHHHHHHHHHHccccEEEEEcTTccccHHHHHHHHHHHHHHcTTcccEEEEccTTcccTHHHHHHHHHTTccEEEEccGGGccTTccccHHHHHHHHTTcTTccccccHccHHHHHHHHHHHHHHHHHGGGGcGGGTcccccTTHHHHcccHHHHHHHHHHHHHHTTTcHHHHHHHHHHHHHHHTHHHHHHH#### DISOP:02AL 1-6, 8-9, 342-345| PSIPRED ccccccccEEEEEcccccHHHcccccccHHHHHHHHHHHHHccccEEEEccccccccccccHHHccccHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHccccEEEEEEEccHHHHHHHHHHHHHHcccEEEEEEEccccccHHHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHHHHcccccEEEEEEcccHHHHHHHHHHHHHHcccEEEEEccccccccccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccccccccccHHccccccHHHHHHHHHHHcHHHcccccHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHccc //