[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55311.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  115/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:128 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->84 3f6vA PDBj 9e-13 47.9 %
:RPS:PDB   14->87 1bibA PDBj 1e-11 21.1 %
:RPS:SCOP  6->88 1fnnA1  a.4.5.11 * 3e-14 12.7 %
:HMM:SCOP  1->99 2p4wA1 a.4.5.64 * 1.8e-22 38.9 %
:RPS:PFM   14->64 PF01022 * HTH_5 2e-07 59.6 %
:HMM:PFM   14->63 PF01022 * HTH_5 3.3e-11 50.0 46/47  
:HMM:PFM   92->121 PF08352 * oligo_HPY 0.00089 30.0 30/64  
:BLT:SWISS 8->92 SDPR_BACSU 3e-10 33.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55311.1 GT:GENE BAD55311.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(485753..486139) GB:FROM 485753 GB:TO 486139 GB:DIRECTION - GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD55311.1 LENGTH 128 SQ:AASEQ MAASPAKIFEALGDPIRRHLLELLAAGEQPAGALVAAVQQHAAISQPGVSQHLKTLRDAGLVTVRAEGTRRLYALDPTGLDTARTWLTTLLDPLHPFTQPLDALATEVARGKRTRRTRSDSETTARGA GT:EXON 1|1-128:0| BL:SWS:NREP 1 BL:SWS:REP 8->92|SDPR_BACSU|3e-10|33.3|81/90| SEG 113->126|rtrrtrsdsettar| BL:PDB:NREP 1 BL:PDB:REP 10->84|3f6vA|9e-13|47.9|71/96| RP:PDB:NREP 1 RP:PDB:REP 14->87|1bibA|1e-11|21.1|71/294| RP:PFM:NREP 1 RP:PFM:REP 14->64|PF01022|2e-07|59.6|47/47|HTH_5| HM:PFM:NREP 2 HM:PFM:REP 14->63|PF01022|3.3e-11|50.0|46/47|HTH_5| HM:PFM:REP 92->121|PF08352|0.00089|30.0|30/64|oligo_HPY| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01022|IPR001845| GO:PFM GO:0005622|"GO:intracellular"|PF01022|IPR001845| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01022|IPR001845| RP:SCP:NREP 1 RP:SCP:REP 6->88|1fnnA1|3e-14|12.7|79/103|a.4.5.11| HM:SCP:REP 1->99|2p4wA1|1.8e-22|38.9|95/0|a.4.5.64|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 175 OP:NHOMOORG 115 OP:PATTERN -------------------------------------------------------------------- -12-2---------21111-1---1211111111115144---1-411-1-12111-3--4---4-1--2-1------------------------------------------------------------------------1-------------------------------------------------11111221-111221--11--111---1--11-----12------------------1------------------------------------------------------------------------------------------------------1----------1-------2-------------3321-----------------1---1-----231-211122133223--2-2-1-------1-------------------------------------------------1-----1-1111------11--------1----------------1------1--------------------------------------------111143-------------------------------------------------------------------------------------------------------------------------------------2------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 111 STR:RPRED 86.7 SQ:SECSTR ETHHHHcccTTcccHHHHHHHHHHTTcccccGGHHHHHHHHHTccHHHHHHHHHHHHHTTcccEEETTTEEEcccccccccHHHHHHTccccHHHTTTcccTTTHHHHHHH################# DISOP:02AL 106-128| PSIPRED cHHHHHHHHHHHccHHHHHHHHHHHcccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccEEEccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccc //