[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55317.1
DDBJ      :             putative oxygenase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  155/915 : Eukaryota  42/199 : Viruses  0/175   --->[See Alignment]
b.33.1d.129.3
:405 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   15->372 2zylA PDBj e-145 68.0 %
:RPS:PDB   21->352 2ckfE PDBj 3e-29 14.2 %
:RPS:SCOP  27->139 1fqtA  b.33.1.1 * 6e-20 20.8 %
:HMM:SCOP  23->137 2de6A1 b.33.1.2 * 4.7e-28 32.5 %
:HMM:SCOP  125->355 1z01A2 d.129.3.3 * 3.2e-27 19.5 %
:RPS:PFM   48->111 PF00355 * Rieske 1e-05 35.9 %
:HMM:PFM   27->115 PF00355 * Rieske 5.5e-17 26.4 87/97  
:BLT:SWISS 40->217 VANA_PSEUH 3e-10 32.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55317.1 GT:GENE BAD55317.1 GT:PRODUCT putative oxygenase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 490657..491874 GB:FROM 490657 GB:TO 491874 GB:DIRECTION + GB:PRODUCT putative oxygenase GB:PROTEIN_ID BAD55317.1 LENGTH 405 SQ:AASEQ MADTPKGGAKVRELDVGTTPTRYARGWHCLGLAKTFRDGKPHAVEVFGTKLVVWADSAGELRVLDAYCRHMGGDLSMGEVKGDDIACPFHDWRWSGVNGKCTAIPYARRVPPLARTRKWTTLERNGQLFVWHDHEGNPPPPEVTIPYIEGPYADAEGNPKDGHDSGWTEWTWNSLLIEGANCREIIDNVVDMAHFFYIHFAFPTYFKNVFEGHVATQFLETKGRPDVGMAAKYGGETLLKSEASYFGPSYMINPLTNIYGGYEIKVVLINCHYPVTQDSFVLQWGLTVEKPTGIDDATAEKLAKSMTEFFGTGFLQDVEIWKHKSKVENPLLCEEDGPVYQLRRWYEQFYVDVADVTEKMTQRFEFEVDTTKANEAWEAEVAENLRRKREAEEAEQAKKEAEAGV GT:EXON 1|1-405:0| BL:SWS:NREP 1 BL:SWS:REP 40->217|VANA_PSEUH|3e-10|32.3|158/354| SEG 373->403|aneaweaevaenlrrkreaeeaeqakkeaea| BL:PDB:NREP 1 BL:PDB:REP 15->372|2zylA|e-145|68.0|344/359| RP:PDB:NREP 1 RP:PDB:REP 21->352|2ckfE|3e-29|14.2|325/433| RP:PFM:NREP 1 RP:PFM:REP 48->111|PF00355|1e-05|35.9|64/95|Rieske| HM:PFM:NREP 1 HM:PFM:REP 27->115|PF00355|5.5e-17|26.4|87/97|Rieske| GO:PFM:NREP 3 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00355|IPR017941| GO:PFM GO:0051537|"GO:2 iron, 2 sulfur cluster binding"|PF00355|IPR017941| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00355|IPR017941| RP:SCP:NREP 1 RP:SCP:REP 27->139|1fqtA|6e-20|20.8|106/109|b.33.1.1| HM:SCP:REP 23->137|2de6A1|4.7e-28|32.5|114/0|b.33.1.2|1/1|ISP domain| HM:SCP:REP 125->355|1z01A2|3.2e-27|19.5|210/0|d.129.3.3|1/1|Bet v1-like| OP:NHOMO 400 OP:NHOMOORG 197 OP:PATTERN -------------------------------------------------------------------- --1-1---------48411-15--351-111355655444-13-----------------112-----11----------------------------------------------------------------------------1-2312--122----1--3-13231--------------------1--------------1-------------------------1--------------------------------------------------------------------------------------------1--------------------------------------------------2--1--------21------1-------------2111122--------1--------------1-----1--11111111-111-----------------------------------6F---11--2222321233233123555133142531-1111-4---114-21-2------------------------------------------------32--------------------------------------1--------1------1--------1-----------1---------------------------------1-------------------------------------------------------------2----------------11111-2-----1----1-1-1111-21----1-11--------------------1-11-----------------------------------------------------1--1-2-211--- --------------1--------------------------------------------------------------------------------------------252411121---------------------------------------1--223223121111-111--3116112184243-12------3 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 372 STR:RPRED 91.9 SQ:SECSTR cccEEEEGGGccTTcEEEccHTTTTccEEEEEGGGcccTEEEEEEETTEEEEEEEcTTccEEEEEcccTTTccccccccEEcccEEcTTTccEEccTTccEEEcTTTTTTTTTccccEEEEEEETTEEEEEccTTcccHHHHHGGGHHHHHHHHTTTcccEEEEEEEEEEEEcccTHHHccTHHHHHHHHccTTHHHHTHHHHTccEEEEcTTccEEEEETTcGGGGcccccHHHHHHHHHHHHHHcHHHHHHHTcEEEEEEEETTcEEEEEEEccTTcEEEEEEEEEETTccHHHHHHHHHHHHHHcTTcTTGGGGHHHHHHHHHGccEEEccTTTTcEEcccccccEEEEcccccHHHHHHHHHHHHHHH################################# DISOP:02AL 1-16, 387-405| PSIPRED cccccccccccccccccccccccccccEEEEEHHHccccccEEEEEccEEEEEEEccccEEEEEEccccccccEEEccEEcccEEEEcccccEEEcccHHHHcccccccccccccccEEEEEEEccEEEEEcccccccccccccccHHHHHHHHHHHHHHHHcccccEEEEEEEEEEEccccHHHHHHcccHHHHHHcccccccccccccccccHHEEEccccccccccccccccccccEEEEEEEcccEEEEccccccccccccEEEEEEEEEccccEEEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccc //