[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55318.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  24/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:110 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   38->51 PF03604 * DNA_RNApol_7kD 0.00084 35.7 14/32  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55318.1 GT:GENE BAD55318.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 491874..492206 GB:FROM 491874 GB:TO 492206 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55318.1 LENGTH 110 SQ:AASEQ MGASWAKAPDFADQPARRAAVQAQTALDKQRYLEDGMTPLHCQGCHSRVLVRKYSAHQTSVEWTEPPATRCPVFARLAESGAAPGRPDTCPSLEKTIKWAVDEGVLPIPE GT:EXON 1|1-110:0| HM:PFM:NREP 1 HM:PFM:REP 38->51|PF03604|0.00084|35.7|14/32|DNA_RNApol_7kD| OP:NHOMO 24 OP:NHOMOORG 24 OP:PATTERN -------------------------------------------------------------------- --------------11111-11--1111111111111111--------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-9, 82-84, 109-110| PSIPRED ccccccccccccccHHHHHHHHHHHHHHHHHHHHccccEEEEccccHHHHHEEccccccEEEEcccHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHccccccc //